| Clone Name | rbags36d04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ACRO_PIG (P08001) Acrosin precursor (EC 3.4.21.10) (53 kDa fucos... | 30 | 1.4 |
|---|
>ACRO_PIG (P08001) Acrosin precursor (EC 3.4.21.10) (53 kDa fucose-binding| protein) [Contains: Acrosin light chain; Acrosin heavy chain] Length = 415 Score = 30.4 bits (67), Expect = 1.4 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +2 Query: 14 IYSYTNPSKEKYINWYAKQAGNASIQTYRLSSDPRPT 124 +Y+ T P Y+NW A + G+ ++Q +L + PRP+ Sbjct: 272 VYTSTWP----YLNWIASKIGSNALQMVQLGTPPRPS 304 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,469,127 Number of Sequences: 219361 Number of extensions: 376999 Number of successful extensions: 1110 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1109 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)