| Clone Name | rbags36d02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RPOC2_ODOSI (P49468) DNA-directed RNA polymerase beta'' chain (E... | 29 | 3.3 | 2 | YGL1_SCHPO (Q9Y7J8) Hypothetical protein C216.01c in chromosome II | 27 | 9.7 | 3 | CCMA_RHOPA (Q6NDA6) Cytochrome c biogenesis ATP-binding export p... | 27 | 9.7 | 4 | YCF2_NYMAL (Q6EVY7) Protein ycf2 | 27 | 9.7 | 5 | RFX1_YEAST (P48743) RFX-like DNA-binding protein RFX1 | 27 | 9.7 |
|---|
>RPOC2_ODOSI (P49468) DNA-directed RNA polymerase beta'' chain (EC 2.7.7.6)| (PEP) (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 1481 Score = 28.9 bits (63), Expect = 3.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 231 WSMICYLSLRFCTLAHHLSYLGYQ 160 WS Y S++ C+LA L YLG++ Sbjct: 22 WSFTTYDSMQACSLADELKYLGFK 45
>YGL1_SCHPO (Q9Y7J8) Hypothetical protein C216.01c in chromosome II| Length = 836 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +1 Query: 193 GTEPQTQVADHAPRFFWEKLERMADLEXANSTISXSAVSK 312 G++ + DH P W+K ++ D + A+S++S + VS+ Sbjct: 419 GSDILVSIIDHEPAIVWQKFDQ--DRKDASSSLSNAHVSQ 456
>CCMA_RHOPA (Q6NDA6) Cytochrome c biogenesis ATP-binding export protein ccmA| (EC 3.6.3.41) (Heme exporter protein A) Length = 200 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 145 LIA*LLVPQIG*MVCKGTEPQTQVADHA 228 LIA LL P+ G + G EP T VA+ A Sbjct: 47 LIAGLLTPEAGTITLDGGEPDTPVAEQA 74
>YCF2_NYMAL (Q6EVY7) Protein ycf2| Length = 2253 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -1 Query: 197 VPLHTIYPIWGTSNYAISSGCRQNIIIQSELL 102 +PL I P W + ISS C QNI++ E++ Sbjct: 1249 IPLWAILPRWNLIS-EISSKCLQNILLPEEMI 1279
>RFX1_YEAST (P48743) RFX-like DNA-binding protein RFX1| Length = 811 Score = 27.3 bits (59), Expect = 9.7 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = -2 Query: 229 EHDLLPEFEVLYPCTPSILFGVPAIMQSAVVVDKIS*YNLNC*RTWECI 83 EH LL +++ +P P+ + +P S V+ S Y+++C +ECI Sbjct: 495 EHPLLTSYKLDFPKIPAGV--LPTDTDSDVISSLESLYHIHCNSVYECI 541 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,789,041 Number of Sequences: 219361 Number of extensions: 766240 Number of successful extensions: 1982 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1961 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1982 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)