| Clone Name | rbags35m20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FOLH1_HUMAN (Q04609) Glutamate carboxypeptidase 2 (EC 3.4.17.21)... | 31 | 1.6 | 2 | FOLH1_RAT (P70627) Glutamate carboxypeptidase 2 (EC 3.4.17.21) (... | 30 | 4.6 | 3 | ADH2_LYCES (P28032) Alcohol dehydrogenase 2 (EC 1.1.1.1) | 29 | 7.8 | 4 | UL34_HHV6U (P52465) Virion protein U34 | 29 | 7.8 | 5 | TES26_TOXCA (P54190) 26 kDa secreted antigen precursor (Toxocara... | 29 | 7.8 |
|---|
>FOLH1_HUMAN (Q04609) Glutamate carboxypeptidase 2 (EC 3.4.17.21) (Glutamate| carboxypeptidase II) (Membrane glutamate carboxypeptidase) (mGCP) (N-acetylated-alpha-linked acidic dipeptidase I) (NAALADase I) (Pteroylpoly-gamma-glutamate carboxypeptidase) (F Length = 750 Score = 31.2 bits (69), Expect = 1.6 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 287 GGEPPSRGGATIADVDKQ-GTMKMDGWWVRRPLLLACED 400 GG P G A + ++ + GT+K +GW RR +L A D Sbjct: 384 GGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWD 422
>FOLH1_RAT (P70627) Glutamate carboxypeptidase 2 (EC 3.4.17.21) (Glutamate| carboxypeptidase II) (Membrane glutamate carboxypeptidase) (mGCP) (N-acetylated-alpha-linked acidic dipeptidase I) (NAALADase I) (Pteroylpoly-gamma-glutamate carboxypeptidase) (Fol Length = 752 Score = 29.6 bits (65), Expect = 4.6 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +2 Query: 287 GGEPPSRGGATIADVDKQ-GTMKMDGWWVRRPLLLACED 400 GG P G A + ++ + GT+K GW RR +L A D Sbjct: 386 GGIDPQSGAAVVHEIVRTFGTLKKKGWRPRRTILFASWD 424
>ADH2_LYCES (P28032) Alcohol dehydrogenase 2 (EC 1.1.1.1)| Length = 380 Score = 28.9 bits (63), Expect = 7.8 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = +3 Query: 366 GCDALCYLLAKTDDRCRCRCGLSTGCGHLGSSLN 467 GC A LA D C CG+STG LG+SLN Sbjct: 159 GCVAKINPLAPLDKVCVLSCGISTG---LGASLN 189
>UL34_HHV6U (P52465) Virion protein U34| Length = 276 Score = 28.9 bits (63), Expect = 7.8 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -1 Query: 456 NQGGRNLYSNRICIGIGHRSSQASSKGR 373 + G ++L SNR C G+ RSS KGR Sbjct: 172 SMGKQHLESNRFCQGLRRRSSHVLEKGR 199
>TES26_TOXCA (P54190) 26 kDa secreted antigen precursor (Toxocara| excretory-secretory antigen 26) (TES-26) Length = 262 Score = 28.9 bits (63), Expect = 7.8 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 405 DRCRCRCGLSTGCGHLGSSL 464 DRC+ CGL GCG + S + Sbjct: 84 DRCQKTCGLCAGCGFISSGI 103 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,439,466 Number of Sequences: 219361 Number of extensions: 1298291 Number of successful extensions: 3591 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3586 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)