| Clone Name | rbags35l21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | REP1_FBNY2 (Q66862) Replication-associated protein 1 (EC 2.7.7.-... | 30 | 7.1 | 2 | SYFB_MYCPA (Q740J0) Phenylalanyl-tRNA synthetase beta chain (EC ... | 30 | 9.2 |
|---|
>REP1_FBNY2 (Q66862) Replication-associated protein 1 (EC 2.7.7.-) (EC| 3.1.21.-) (EC 3.6.1.-) (ATP-dependent helicase C1) (Rep1) Length = 278 Score = 30.0 bits (66), Expect = 7.1 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 492 DDPFQGACWQHEQETKDCHEGPFRLRKRQR 403 D+ Q A WQHE+ T D +G +L+K+ R Sbjct: 22 DERVQYAVWQHERGTHDHIQGVIQLKKKAR 51
>SYFB_MYCPA (Q740J0) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 828 Score = 29.6 bits (65), Expect = 9.2 Identities = 22/54 (40%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = -3 Query: 633 PTGRCSSKAAEREARTTRDLRRSSYVEELADPGQSGSASNIEVW-LLQDDPFQG 475 P GR S A R R L +S YVE L P A +VW L DDP +G Sbjct: 492 PAGRGLSAAQRRRRAIGRSLAQSGYVEILPTPFL--PAGVFDVWGLPDDDPRRG 543 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,265,202 Number of Sequences: 219361 Number of extensions: 1877338 Number of successful extensions: 4900 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4776 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4900 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6969622431 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)