| Clone Name | rbags36a13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FATH_HUMAN (Q14517) Cadherin-related tumor suppressor homolog pr... | 28 | 8.1 | 2 | MATK_TAXBA (Q9MVV8) Maturase K (Intron maturase) | 28 | 8.1 | 3 | MATK_TAXCU (Q7IS11) Maturase K (Intron maturase) | 28 | 8.1 |
|---|
>FATH_HUMAN (Q14517) Cadherin-related tumor suppressor homolog precursor (Protein| fat homolog) Length = 4590 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = -1 Query: 160 CPWLREFCGEMSKVDDQDMVVSTSCRL*FI---YFLAGTCL 47 CPW +FC E VD+ M ++ RL F+ + A CL Sbjct: 3745 CPW--KFCDEKVSVDESVMSTHSTARLSFVTPRHHRAAVCL 3783
>MATK_TAXBA (Q9MVV8) Maturase K (Intron maturase)| Length = 504 Score = 27.7 bits (60), Expect = 8.1 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 124 YSFHRKIL*ATGTRWISHAPSGXLQSVMXVSXRSCFLLLGLEK 252 YS H +IL T RWI APS L + R+ F L+K Sbjct: 154 YSIHPEILVRTFRRWIRDAPSLHLLRSILHEWRNSFSAENLQK 196
>MATK_TAXCU (Q7IS11) Maturase K (Intron maturase)| Length = 510 Score = 27.7 bits (60), Expect = 8.1 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 124 YSFHRKIL*ATGTRWISHAPSGXLQSVMXVSXRSCFLLLGLEK 252 YS H +IL T RWI APS L + R+ F L+K Sbjct: 154 YSIHPEILVRTFRRWIRDAPSLHLLRSILHEWRNSFSAENLQK 196 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,735,622 Number of Sequences: 219361 Number of extensions: 519715 Number of successful extensions: 1127 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1126 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)