| Clone Name | rbags35l05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CR030_HUMAN (Q8N787) Protein C18orf30 | 32 | 1.7 | 2 | ESPC_ECO27 (Q9EZE7) Serine protease espC precursor (EC 3.4.21.-)... | 30 | 8.4 | 3 | GNPTA_BRARE (Q5RGJ8) N-acetylglucosamine-1-phosphotransferase su... | 30 | 8.4 |
|---|
>CR030_HUMAN (Q8N787) Protein C18orf30| Length = 583 Score = 32.0 bits (71), Expect = 1.7 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -2 Query: 415 MWICIKKPERFSYSWYVNWGLAL-LGTAFSLASSVGGVWSIVNTGMKLKF 269 +W+ +K+ F+Y + ++W AL LASSV VW+ V K+ + Sbjct: 239 IWVSVKEVSLFNYVFLISWAFALPYAKLRRLASSVCTVWTCVIIVCKMSY 288
>ESPC_ECO27 (Q9EZE7) Serine protease espC precursor (EC 3.4.21.-)| (EPEC-secreted protein C) Length = 1305 Score = 29.6 bits (65), Expect = 8.4 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 7/34 (20%) Frame = -2 Query: 349 LLGTAFSLASSVGGVWSIVN-------TGMKLKF 269 +LGT F +ASS VWSI+N G+K KF Sbjct: 272 MLGTLFGIASSGADVWSILNQYDENTVNGLKNKF 305
>GNPTA_BRARE (Q5RGJ8) N-acetylglucosamine-1-phosphotransferase subunits| alpha/beta precursor (EC 2.7.8.17) (GlcNAc-1-phosphotransferase alpha/beta subunits) (UDP-N-acetylglucosamine-1-phosphotransferase alpha/beta subunits) (Stealth protein gnptab) [Conta Length = 1219 Score = 29.6 bits (65), Expect = 8.4 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = -1 Query: 488 AVPLQPRRPSGRPNTAGDVCLPVLHVDLYQEA*EVQLQLVRE 363 AVP + + P R T GDV +PVL+ L + +++L+ + E Sbjct: 672 AVPKEKQGPKVREQTHGDVQVPVLNETLLPDEVKIELKKLNE 713 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,377,159 Number of Sequences: 219361 Number of extensions: 1551776 Number of successful extensions: 3599 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3599 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)