| Clone Name | rbags35k24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GCFC_HUMAN (Q9Y5B6) GC-rich sequence DNA-binding factor homolog | 32 | 1.4 | 2 | GCFC_MOUSE (P58501) GC-rich sequence DNA-binding factor homolog ... | 32 | 1.9 | 3 | Y1336_AQUAE (O67355) UPF0103 protein aq_1336 | 30 | 9.3 |
|---|
>GCFC_HUMAN (Q9Y5B6) GC-rich sequence DNA-binding factor homolog| Length = 917 Score = 32.3 bits (72), Expect = 1.4 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 4/74 (5%) Frame = +2 Query: 488 FRRTSWSWTLLLDRGRSIQYVVHGIFSQQCLEIL----VHKRYILQAARQTDVSVVNVKR 655 F+R WS LL G +Q+ +GIFS + L+ L + RYIL A + ++ ++K+ Sbjct: 769 FQRQFWSSVKLL--GNFLQW--YGIFSNKTLQELSIDGLLNRYILMAFQNSEYGDDSIKK 824 Query: 656 DILLGDCFTRFWWI 697 + +CF + W++ Sbjct: 825 AQNVINCFPKQWFM 838
>GCFC_MOUSE (P58501) GC-rich sequence DNA-binding factor homolog (Fragment)| Length = 855 Score = 32.0 bits (71), Expect = 1.9 Identities = 22/74 (29%), Positives = 41/74 (55%), Gaps = 4/74 (5%) Frame = +2 Query: 488 FRRTSWSWTLLLDRGRSIQYVVHGIFSQQCLEIL----VHKRYILQAARQTDVSVVNVKR 655 F+R WS LL G +Q+ +GIFS + L+ L + RYIL A + ++ ++++ Sbjct: 707 FQRQFWSSVKLL--GNFLQW--YGIFSNKTLQELSIDGLLNRYILMAFQNSEYGDDSIRK 762 Query: 656 DILLGDCFTRFWWI 697 + +CF + W++ Sbjct: 763 AQNVINCFPKQWFV 776
>Y1336_AQUAE (O67355) UPF0103 protein aq_1336| Length = 374 Score = 29.6 bits (65), Expect = 9.3 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 128 GDSFTYLEPLTCSTPFLAVPILLFFCTFVLG 36 GD F +P+ S PF+A P LLF + + G Sbjct: 14 GDKFVVRDPVGISQPFIATPELLFLLSLMDG 44 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,581,602 Number of Sequences: 219361 Number of extensions: 1557940 Number of successful extensions: 4196 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4096 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4196 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7026286028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)