| Clone Name | rbags35k08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KING1_ARATH (Q8LBB2) SNF1-related protein kinase regulatory gamm... | 32 | 0.78 | 2 | CCR7_HUMAN (P32248) C-C chemokine receptor type 7 precursor (C-C... | 28 | 8.6 | 3 | SYG_TREPA (O83678) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine... | 28 | 8.6 |
|---|
>KING1_ARATH (Q8LBB2) SNF1-related protein kinase regulatory gamma subunit 1| (AKIN gamma1) (AKING1) Length = 424 Score = 32.0 bits (71), Expect = 0.78 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -1 Query: 442 VIXSIGSRITHRIYXXXXXXXXXXXVTLRDVISCFIHEPPGFCDSYLVSAM 290 +I + + HRIY +TLRD+I+ +HEP G+ + M Sbjct: 366 LILMLDAEKIHRIYVVDDFGNLEGLITLRDIIARLVHEPSGYFGDFFDGVM 416
>CCR7_HUMAN (P32248) C-C chemokine receptor type 7 precursor (C-C CKR-7)| (CC-CKR-7) (CCR-7) (MIP-3 beta receptor) (EBV-induced G-protein coupled receptor 1) (EBI1) (BLR2) (CD197 antigen) (CDw197) Length = 378 Score = 28.5 bits (62), Expect = 8.6 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -3 Query: 320 LLRQLSCFSDGEARGQSGCRFFRREQLSCSRECMT 216 L + L C S + R S CR RR +S E T Sbjct: 340 LFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTT 374
>SYG_TREPA (O83678) Glycyl-tRNA synthetase (EC 6.1.1.14) (Glycine--tRNA| ligase) (GlyRS) Length = 462 Score = 28.5 bits (62), Expect = 8.6 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -2 Query: 120 GVTRHFSDLLVCTLVCQLLYRVPDFADPHLFXWCKHCSG 4 G HFSD LV VC+ +R A P C C G Sbjct: 74 GHVDHFSDPLVDCTVCKSRFRADQVAVPSAGGPCPQCGG 112 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,688,531 Number of Sequences: 219361 Number of extensions: 1003806 Number of successful extensions: 2222 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2198 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2222 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)