| Clone Name | rbags35i15 |
|---|---|
| Clone Library Name | barley_pub |
>MOK1_SCHPO (Q9USK8) Cell wall alpha-1,3-glucan synthase mok1 (EC 2.4.1.183)| Length = 2410 Score = 29.6 bits (65), Expect = 2.0 Identities = 19/75 (25%), Positives = 34/75 (45%), Gaps = 8/75 (10%) Frame = -1 Query: 286 IYLAVGVVLDFSCYQMTIFAVQSWVHASVVYLYTIFRLLGSPYHGNYYQWYLI------- 128 I+LA+G +L + YQ+T+F S + +Y F + G + W+ + Sbjct: 1990 IFLALGQILAATAYQLTLFTGTSNIQTYEIYSVCAF------FIGASFVWWFMFARLPSY 2043 Query: 127 YIID-PWLIFTPISF 86 Y++ PWL + F Sbjct: 2044 YVLSIPWLFYAVALF 2058
>GPR21_HUMAN (Q99679) Probable G-protein coupled receptor 21| Length = 349 Score = 28.9 bits (63), Expect = 3.4 Identities = 16/61 (26%), Positives = 32/61 (52%), Gaps = 6/61 (9%) Frame = -1 Query: 301 CIERLIYLAVGVVLDFSCY------QMTIFAVQSWVHASVVYLYTIFRLLGSPYHGNYYQ 140 CI Y+A+ L ++ ++ IF + W+++++V+L + F YHG+ +Q Sbjct: 122 CISIDRYIAITKPLTYNTLVTPWRLRLCIFLI--WLYSTLVFLPSFFHWGKPGYHGDVFQ 179 Query: 139 W 137 W Sbjct: 180 W 180
>YG3F_YEAST (P53283) Hypothetical transport protein YGR138C| Length = 614 Score = 28.9 bits (63), Expect = 3.4 Identities = 25/59 (42%), Positives = 30/59 (50%), Gaps = 8/59 (13%) Frame = -3 Query: 203 SCVLVHHI*IIGFSLSR*LLSMVLDLYHRSVAY-----LYTHFIL---LASS*KCKLNC 51 SC L+ +IGFSL + S V DLY R VAY LY F + LA + C L C Sbjct: 211 SCSLM----VIGFSLGPLIWSPVSDLYGRRVAYFVSMGLYVIFNIPCALAPNLGCLLAC 265
>GPR52_HUMAN (Q9Y2T5) Probable G-protein coupled receptor 52| Length = 361 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/59 (23%), Positives = 30/59 (50%), Gaps = 4/59 (6%) Frame = -1 Query: 301 CIERLIYLAVGVVLDFSCY----QMTIFAVQSWVHASVVYLYTIFRLLGSPYHGNYYQW 137 CI YLA+ L ++ ++ I + W+++ +++L + F YHG+ ++W Sbjct: 134 CISVDRYLAITKPLSYNQLVTPCRLRICIILIWIYSCLIFLPSFFGWGKPGYHGDIFEW 192
>KCNC1_RAT (P25122) Potassium voltage-gated channel subfamily C member 1| (Voltage-gated potassium channel subunit Kv3.1) (Kv4) (NGK2) (RAW2) Length = 585 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -1 Query: 184 IFRLLGSPYHGNYYQWYLIYIIDPWLIFTPISFCLQVHENVNSIV 50 I+ L PY Y + Y+ + +++ + +FCL+ HE N IV Sbjct: 176 IWALFEDPYSSRYAR-YVAFASLFFILVSITTFCLETHERFNPIV 219
>KCNC1_MOUSE (P15388) Potassium voltage-gated channel subfamily C member 1| (Voltage-gated potassium channel subunit Kv3.1) (Kv4) (NGK2) Length = 511 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -1 Query: 184 IFRLLGSPYHGNYYQWYLIYIIDPWLIFTPISFCLQVHENVNSIV 50 I+ L PY Y + Y+ + +++ + +FCL+ HE N IV Sbjct: 176 IWALFEDPYSSRYAR-YVAFASLFFILVSITTFCLETHERFNPIV 219
>KCNC1_HUMAN (P48547) Potassium voltage-gated channel subfamily C member 1| (Voltage-gated potassium channel subunit Kv3.1) (Kv4) (NGK2) Length = 511 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -1 Query: 184 IFRLLGSPYHGNYYQWYLIYIIDPWLIFTPISFCLQVHENVNSIV 50 I+ L PY Y + Y+ + +++ + +FCL+ HE N IV Sbjct: 176 IWALFEDPYSSRYAR-YVAFASLFFILVSITTFCLETHERFNPIV 219 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,843,880 Number of Sequences: 219361 Number of extensions: 864405 Number of successful extensions: 1801 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1801 length of database: 80,573,946 effective HSP length: 85 effective length of database: 61,928,261 effective search space used: 1486278264 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)