ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags35f18 |
|---|---|
| Clone Library Name | barley_pub |
>INT2_MOUSE (Q80UK8) Integrator complex subunit 2 (Int2)| Length = 1198 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -3 Query: 258 ILDVSDAFSSCCQALVVNPKKH*TASLGGRGR-DMLR 151 + +V D+F+ C+ L+ N ++ SLGGR R D LR Sbjct: 208 VANVPDSFNEVCRGLIKNGERQDEESLGGRRRTDALR 244
>INT2_HUMAN (Q9H0H0) Integrator complex subunit 2 (Int2)| Length = 1204 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/37 (40%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -3 Query: 258 ILDVSDAFSSCCQALVVNPKKH*TASLGGRGR-DMLR 151 + +V D+F+ C+ L+ N ++ SLGGR R D LR Sbjct: 215 VANVPDSFNEVCRGLIKNGERQDEESLGGRRRTDALR 251
>PGH2_CAVPO (P70682) Prostaglandin G/H synthase 2 precursor (EC 1.14.99.1)| (Cyclooxygenase-2) (COX-2) (Prostaglandin-endoperoxide synthase 2) (Prostaglandin H2 synthase 2) (PGH synthase 2) (PGHS-2) (PHS II) Length = 604 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +2 Query: 242 SDTSRIGGRVKGGRTPPLSCAKVVKA 319 S T +I GRV GGR PL+ +V KA Sbjct: 411 SFTKQIAGRVAGGRNVPLAVQRVAKA 436
>DIM6_STRCO (Q02058) Actinorhodin polyketide dimerase (EC 1.-.-.-) (actI ORF6)| Length = 177 Score = 29.3 bits (64), Expect = 2.4 Identities = 18/34 (52%), Positives = 20/34 (58%) Frame = -3 Query: 345 AMAHTLAGNALTTFAHDKGGVLPPFTLPPILDVS 244 AMA AG AL T AHD+GGV FT + VS Sbjct: 11 AMARVPAGVALVT-AHDRGGVPHGFTASSFVSVS 43
>ZDHC8_MOUSE (Q5Y5T5) Probable palmitoyltransferase ZDHHC8 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 8) (DHHC-8) Length = 762 Score = 29.3 bits (64), Expect = 2.4 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 300 HDKGGVLPPFTLPPILDVSDAFSSCCQAL 214 H GG+ PP+ P L+ +DAFS ++L Sbjct: 403 HGPGGLRPPYPPSPPLNTTDAFSGALRSL 431
>GAG_MLVFP (P26805) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 537 Score = 28.9 bits (63), Expect = 3.1 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 233 EKASDTSRIGGRVKGGRTPPLSCAKVVKAFPARV 334 E A D+S + R++G R PP++ + +AFP R+ Sbjct: 185 EGAPDSSPMVSRLRGRREPPVADSTTSQAFPLRL 218
>GAG_MLVF5 (P26807) Gag polyprotein (Core polyprotein) [Contains: Matrix| protein p15; RNA-binding phosphoprotein p12; Capsid protein p30; Nucleocapsid protein p10] Length = 538 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 233 EKASDTSRIGGRVKGGRTPPLSCAKVVKAFPAR 331 E A D+S + R++G R PP++ + +AFP R Sbjct: 186 EGAPDSSPMVSRLRGRREPPVADSTTSQAFPLR 218
>GPMA_NEIG1 (Q5F7C0) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase| (EC 5.4.2.1) (Phosphoglyceromutase) (PGAM) (BPG-dependent PGAM) (dPGM) Length = 227 Score = 28.1 bits (61), Expect = 5.4 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = -3 Query: 372 MEGLNKQQTAMAHTLAGNALTTFAHDKGGVLPPFTLPPILDVSDAFSS 229 ++GL+K+QTA + + ++D TLPP+LD DAFS+ Sbjct: 92 LQGLDKKQTAEKYGDEQVRIWRRSYD--------TLPPLLDKDDAFSA 131
>GAG_MLVAB (P03333) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30] Length = 234 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 236 KASDTSRIGGRVKGGRTPPLSCAKVVKAFPAR 331 +A D S + R++G R PP++ + +AFP R Sbjct: 186 EAPDPSPMASRLRGRREPPVADSTTSQAFPLR 217
>GAG_MSVMT (P32594) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30] Length = 467 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 236 KASDTSRIGGRVKGGRTPPLSCAKVVKAFPAR 331 +A D S + R++G R PP++ + +AFP R Sbjct: 186 EAPDPSPMASRLRGRREPPVADSTTSQAFPLR 217
>GAG_MSVMO (P03334) Gag polyprotein R65 [Contains: Core protein p15; Inner| coat protein p12; Core shell protein p30; Nucleoprotein p10] Length = 537 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 236 KASDTSRIGGRVKGGRTPPLSCAKVVKAFPAR 331 +A D S + R++G R PP++ + +AFP R Sbjct: 186 EAPDPSPMASRLRGRREPPVADSTTSQAFPLR 217
>GAG_MLVMO (P03332) Gag polyprotein [Contains: Core protein p15; Inner coat| protein p12; Core shell protein p30; Nucleoprotein p10] Length = 537 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 236 KASDTSRIGGRVKGGRTPPLSCAKVVKAFPAR 331 +A D S + R++G R PP++ + +AFP R Sbjct: 186 EAPDPSPMASRLRGRREPPVADSTTSQAFPLR 217
>PGH2_RABIT (O02768) Prostaglandin G/H synthase 2 precursor (EC 1.14.99.1)| (Cyclooxygenase-2) (COX-2) (Prostaglandin-endoperoxide synthase 2) (Prostaglandin H2 synthase 2) (PGH synthase 2) (PGHS-2) (PHS II) Length = 604 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +2 Query: 242 SDTSRIGGRVKGGRTPPLSCAKVVKA 319 S T +I GRV GGR P + KV KA Sbjct: 411 SFTRQIAGRVAGGRNVPPAVQKVAKA 436
>INT2_CHICK (Q5ZKU4) Integrator complex subunit 2 (Int2)| Length = 1192 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 258 ILDVSDAFSSCCQALVVNPKKH*TASLGGRGR 163 + +V D+F+ C+ L+ N ++ S+GGR R Sbjct: 207 VANVPDSFNEVCRGLIKNGERQDEESVGGRRR 238
>HISX_LEGPL (Q5WX91) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 431 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +2 Query: 254 RIGGRVKGGRTPPLSCAKVVKAFPARV--CAIAVCC 355 ++G V GG PL + +++A PA+V C I V C Sbjct: 120 KVGLYVPGGNKTPLVSSLLMQAIPAKVAGCPIKVLC 155
>HISX_LEGPH (Q5ZW87) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 431 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +2 Query: 254 RIGGRVKGGRTPPLSCAKVVKAFPARV--CAIAVCC 355 ++G V GG PL + +++A PA+V C I V C Sbjct: 120 KVGLYVPGGNKTPLVSSLLMQAIPAKVAGCPIKVLC 155
>HISX_LEGPA (Q5X5W9) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 431 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +2 Query: 254 RIGGRVKGGRTPPLSCAKVVKAFPARV--CAIAVCC 355 ++G V GG PL + +++A PA+V C I V C Sbjct: 120 KVGLYVPGGNKTPLVSSLLMQAIPAKVAGCPIKVLC 155
>ANGL4_MOUSE (Q9Z1P8) Angiopoietin-related protein 4 precursor| (Angiopoietin-like 4) (Hepatic fibrinogen/angiopoietin-related protein) (HFARP) (Fasting-induced adipose factor) (Secreted protein Bk89) (425O18-1) Length = 410 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 304 KGCQGIPSEGVRHRGLLLVQPL 369 + CQ + EG RH GL +QPL Sbjct: 190 RDCQELFQEGERHSGLFQIQPL 211
>CZF1_CANAL (P28875) Zinc finger protein 1| Length = 388 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/19 (47%), Positives = 17/19 (89%) Frame = +1 Query: 25 QQRKPTPRKRGAQKKPGQK 81 +Q++P+P ++G +KKPG+K Sbjct: 256 KQQQPSPPEQGTKKKPGRK 274
>FIBG_HUMAN (P02679) Fibrinogen gamma chain precursor| Length = 453 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/56 (23%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +1 Query: 208 NDQGLAARRESI*HVEDRGESERREDAAL--VVRKGCQGIPSEGVRHRGLLLVQPL 369 N+Q + +E + +E + + ++ + + K CQ I ++G + GL ++PL Sbjct: 143 NNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPL 198
>PGH2_RAT (P35355) Prostaglandin G/H synthase 2 precursor (EC 1.14.99.1)| (Cyclooxygenase-2) (COX-2) (Prostaglandin-endoperoxide synthase 2) (Prostaglandin H2 synthase 2) (PGH synthase 2) (PGHS-2) (PHS II) Length = 604 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 242 SDTSRIGGRVKGGRTPPLSCAKVVKA 319 S T +I GRV GGR P++ V KA Sbjct: 411 SFTRQIAGRVAGGRNVPIAVQAVAKA 436
>PGH2_MOUSE (Q05769) Prostaglandin G/H synthase 2 precursor (EC 1.14.99.1)| (Cyclooxygenase-2) (COX-2) (Prostaglandin-endoperoxide synthase 2) (Prostaglandin H2 synthase 2) (PGH synthase 2) (PGHS-2) (PHS II) (Glucocorticoid-regulated inflammatory cyclooxyg Length = 604 Score = 27.3 bits (59), Expect = 9.1 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 242 SDTSRIGGRVKGGRTPPLSCAKVVKA 319 S T +I GRV GGR P++ V KA Sbjct: 411 SFTRQIAGRVAGGRNVPIAVQAVAKA 436
>AGLU_SPIOL (O04893) Alpha-glucosidase precursor (EC 3.2.1.20) (Maltase)| Length = 903 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -2 Query: 343 DGAHPRWECLDNLCARQGRRPPSFHS 266 D H RWE DN+ R PP HS Sbjct: 93 DAKHRRWEIPDNILHRHQPPPPPPHS 118
>ANGL4_RAT (Q6TMA8) Angiopoietin-related protein 4 precursor| (Angiopoietin-like 4) (Hepatic fibrinogen/angiopoietin-related protein) (HFARP) Length = 405 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 304 KGCQGIPSEGVRHRGLLLVQPL 369 + CQ + EG RH GL +QPL Sbjct: 185 RDCQELFQEGERHSGLFQIQPL 206
>VINT_BPP22 (P04890) Integrase| Length = 387 Score = 27.3 bits (59), Expect = 9.1 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -2 Query: 325 WECLDNLCARQGRRPPSFHSPP 260 W+ +D C + G++PP F P Sbjct: 119 WKLMDEACRKNGKQPPVFKPKP 140 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,193,465 Number of Sequences: 219361 Number of extensions: 916535 Number of successful extensions: 2349 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 2295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2349 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
