| Clone Name | rbags35e08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y112_MYCMS (Q6MUC0) UPF0078 membrane protein MSC_0112 | 29 | 3.5 | 2 | TRIPC_HUMAN (Q14669) Thyroid receptor-interacting protein 12 (TR... | 28 | 4.6 | 3 | PIT1_MACMU (Q28503) Pituitary-specific positive transcription fa... | 28 | 6.0 | 4 | PIT1_HUMAN (P28069) Pituitary-specific positive transcription fa... | 28 | 6.0 |
|---|
>Y112_MYCMS (Q6MUC0) UPF0078 membrane protein MSC_0112| Length = 258 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 89 RDEIILSWCNSGHYWFPEKWSGAII 15 ++ I+ S NS HYWF W+ I+ Sbjct: 193 KNYILFSLLNSFHYWFSNTWASGIL 217
>TRIPC_HUMAN (Q14669) Thyroid receptor-interacting protein 12 (TRIP12)| Length = 1992 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/54 (27%), Positives = 19/54 (35%) Frame = -3 Query: 200 PVELKHVKKKVMSGFQCFPPLGILHTGTLL*SNNCVQRDEIILSWCNSGHYWFP 39 P EL + + C P GI T+L N D I W + W P Sbjct: 721 PQELYELTSLICELMPCLPKEGIFAVDTMLKKGNAQNTDGAIWQWRDDRGLWHP 774
>PIT1_MACMU (Q28503) Pituitary-specific positive transcription factor 1 (Pit-1)| (Growth hormone factor 1) (GHF-1) Length = 291 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 32 TFLGTNSDLSYTMTKLFHHAAHNC 103 TF+ NSD S T+ + HH+A C Sbjct: 11 TFIPLNSDASATLPLIMHHSAAEC 34
>PIT1_HUMAN (P28069) Pituitary-specific positive transcription factor 1 (Pit-1)| (Growth hormone factor 1) (GHF-1) Length = 291 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 32 TFLGTNSDLSYTMTKLFHHAAHNC 103 TF+ NSD S T+ + HH+A C Sbjct: 11 TFIPLNSDASATLPLIMHHSAAEC 34 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,123,372 Number of Sequences: 219361 Number of extensions: 636040 Number of successful extensions: 1156 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1156 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)