| Clone Name | rbags35c04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RHM2_ARATH (Q9LPG6) Probable rhamnose biosynthetic enzyme 2 (EC ... | 42 | 0.002 | 2 | RHM3_ARATH (Q9LH76) Probable rhamnose biosynthetic enzyme 3 (EC ... | 41 | 0.003 | 3 | RHM1_ARATH (Q9SYM5) Probable rhamnose biosynthetic enzyme 1 (EC ... | 41 | 0.004 | 4 | VE5_RHPV1 (P24834) Probable protein E5 | 33 | 1.1 | 5 | CELF_VZVD (P09261) Cell fusion protein precursor | 32 | 1.4 | 6 | ITB2_MOUSE (P11835) Integrin beta-2 precursor (Cell surface adhe... | 31 | 4.1 | 7 | LPLB_BACSU (P39128) Protein lplB | 30 | 7.0 |
|---|
>RHM2_ARATH (Q9LPG6) Probable rhamnose biosynthetic enzyme 2 (EC 4.2.1.-) (EC| 1.1.1.-) (RHAMNOSE BIOSYNTHESIS 2 protein) (NDP-rhamnose synthase) (MUCILAGE-MODIFIED4 protein) (UDP-L-rhamnose synthase MUM4) Length = 667 Score = 41.6 bits (96), Expect = 0.002 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -1 Query: 690 LKSEFPELLSIKESLIKNVFEPNRK 616 L EFPE+LSIKESL+K VFEPN++ Sbjct: 642 LSKEFPEMLSIKESLLKYVFEPNKR 666
>RHM3_ARATH (Q9LH76) Probable rhamnose biosynthetic enzyme 3 (EC 4.2.1.-) (EC| 1.1.1.-) Length = 664 Score = 41.2 bits (95), Expect = 0.003 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -1 Query: 690 LKSEFPELLSIKESLIKNVFEPNRK 616 L EFPE+LSIK+SLIK VFEPN++ Sbjct: 639 LSKEFPEMLSIKDSLIKYVFEPNKR 663
>RHM1_ARATH (Q9SYM5) Probable rhamnose biosynthetic enzyme 1 (EC 4.2.1.-) (EC| 1.1.1.-) Length = 669 Score = 40.8 bits (94), Expect = 0.004 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -1 Query: 690 LKSEFPELLSIKESLIKNVFEPNRK 616 LK EFPELLSIKESLIK + PN+K Sbjct: 644 LKKEFPELLSIKESLIKYAYGPNKK 668
>VE5_RHPV1 (P24834) Probable protein E5| Length = 157 Score = 32.7 bits (73), Expect = 1.1 Identities = 24/76 (31%), Positives = 32/76 (42%), Gaps = 9/76 (11%) Frame = -3 Query: 376 FMRCHSCTWCCALCM--LFTCCFSWFSYLKSVLA-------DSTYMCSFVGPYLKFASPK 224 F C C +C ALC L + CF F SV A S +CSF ++ F +P Sbjct: 42 FWLCFCCCFCLALCFVHLLSRCFCVFPVCLSVAAYAVVLGVHSEPVCSFWSVFVLFFNPV 101 Query: 223 HVHSEAKRVCQLMRPD 176 + A C L + D Sbjct: 102 AFDTPACPQCGLQQND 117
>CELF_VZVD (P09261) Cell fusion protein precursor| Length = 340 Score = 32.3 bits (72), Expect = 1.4 Identities = 18/63 (28%), Positives = 27/63 (42%) Frame = -3 Query: 367 CHSCTWCCALCMLFTCCFSWFSYLKSVLADSTYMCSFVGPYLKFASPKHVHSEAKRVCQL 188 CH+ WC L M+F F+WF Y G YL+F + + + C+L Sbjct: 112 CHAYFWCVQLKMIF---FAWFVY---------------GMYLQFRRIRRMFGPFRSSCEL 153 Query: 187 MRP 179 + P Sbjct: 154 ISP 156
>ITB2_MOUSE (P11835) Integrin beta-2 precursor (Cell surface adhesion| glycoproteins LFA-1/CR3/P150,95 beta-subunit) (Complement receptor C3 beta-subunit) (CD18 antigen) Length = 771 Score = 30.8 bits (68), Expect = 4.1 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -1 Query: 111 CNRLVFGAGCGP--CQSLPCLLLHKHNNHTDCFQSLRF 4 CNR + G P C+ P H +NHT C + L+F Sbjct: 599 CNRCICDEGYQPPMCEDCPSCGSHCRDNHTSCAECLKF 636
>LPLB_BACSU (P39128) Protein lplB| Length = 318 Score = 30.0 bits (66), Expect = 7.0 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -3 Query: 568 FLIS*YISRWQLWPILLWYSSRHTYLRFFVTHYVSLEYYQMFYVVVDMF 422 FLI Y+ +W +L+ + YL F+ + +V +Y++ F++ D F Sbjct: 42 FLIFKYLP---MWGVLIAFKDYSPYLGFWKSEWVGFDYFKDFFMNPDFF 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,002,975 Number of Sequences: 219361 Number of extensions: 2011069 Number of successful extensions: 4607 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4603 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6882837918 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)