| Clone Name | rbags35b15 |
|---|---|
| Clone Library Name | barley_pub |
>TRIP4_MOUSE (Q9QXN3) Activating signal cointegrator 1 (ASC-1) (Thyroid| receptor-interacting protein 4) (Trip-4) Length = 581 Score = 33.5 bits (75), Expect = 0.48 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 3/82 (3%) Frame = -3 Query: 595 DAEGVKPIL---DVLCENRTEALRQRAVWAVERILRTDEIAYEISGNQNVSTALVEAFRH 425 + EG P L ++C N + + QR +++L+ E SG +VST + H Sbjct: 193 EQEGSGPCLFCGSLVCTNEEQDILQRDSNKSQKLLKKLMSGAETSGKVDVSTK--DLLPH 250 Query: 424 GDFRTRQIAERALKHVDKLPNF 359 + R + E+A+KH +KL F Sbjct: 251 QESRMKSGLEKAIKHKEKLLEF 272
>TRIP4_HUMAN (Q15650) Activating signal cointegrator 1 (ASC-1) (Thyroid| receptor-interacting protein 4) (TRIP-4) Length = 581 Score = 32.7 bits (73), Expect = 0.81 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 3/82 (3%) Frame = -3 Query: 595 DAEGVKPIL---DVLCENRTEALRQRAVWAVERILRTDEIAYEISGNQNVSTALVEAFRH 425 + EG P L ++C + + + QR +++L+ E SG ++ST + H Sbjct: 193 EQEGSGPCLFCGTLVCTHEEQDILQRDSNKSQKLLKKLMSGVENSGKVDISTK--DLLPH 250 Query: 424 GDFRTRQIAERALKHVDKLPNF 359 + R + E+A+KH DKL F Sbjct: 251 QELRIKSGLEKAIKHKDKLLEF 272
>IMA7_MOUSE (O35345) Importin alpha-7 subunit (Karyopherin alpha-6 subunit)| (Importin alpha S2) Length = 533 Score = 32.7 bits (73), Expect = 0.81 Identities = 17/64 (26%), Positives = 31/64 (48%) Frame = -3 Query: 577 PILDVLCENRTEALRQRAVWAVERILRTDEIAYEISGNQNVSTALVEAFRHGDFRTRQIA 398 P L L + E++R+ A W + I + + + N+ L+E + +FRTR+ A Sbjct: 336 PCLLHLLSSSKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEA 395 Query: 397 ERAL 386 A+ Sbjct: 396 AWAI 399
>IMA5_HUMAN (O15131) Importin alpha-6 subunit (Karyopherin alpha-5 subunit)| Length = 536 Score = 32.7 bits (73), Expect = 0.81 Identities = 18/64 (28%), Positives = 31/64 (48%) Frame = -3 Query: 577 PILDVLCENRTEALRQRAVWAVERILRTDEIAYEISGNQNVSTALVEAFRHGDFRTRQIA 398 P L L + E++R+ A W V I + + + N+ L+E + +FRTR+ A Sbjct: 339 PCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEA 398 Query: 397 ERAL 386 A+ Sbjct: 399 AWAI 402
>IMA7_HUMAN (O60684) Importin alpha-7 subunit (Karyopherin alpha-6)| Length = 536 Score = 32.3 bits (72), Expect = 1.1 Identities = 17/64 (26%), Positives = 31/64 (48%) Frame = -3 Query: 577 PILDVLCENRTEALRQRAVWAVERILRTDEIAYEISGNQNVSTALVEAFRHGDFRTRQIA 398 P L L + E++R+ A W + I + + + N+ L+E + +FRTR+ A Sbjct: 339 PCLLHLLSSPKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEA 398 Query: 397 ERAL 386 A+ Sbjct: 399 AWAI 402
>DUT_HHV6Z (P52541) Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC| 3.6.1.23) (dUTPase) (dUTP pyrophosphatase) Length = 376 Score = 29.6 bits (65), Expect = 6.9 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = -3 Query: 325 PCYA-KVGVLLYRSPADPLEFHKDTKLKYLRMPNLTSINCFPSLTVLAQPL 176 PCY + ++ SP + FH T +++ PN +I CF ++ V A L Sbjct: 236 PCYIPEPWEMINLSPPESAVFHLKTCREFIIKPNSYTIQCFDAMYVCADEL 286
>IMA1_HUMAN (P52294) Importin alpha-1 subunit (Karyopherin alpha-1 subunit)| (SRP1-beta) (RAG cohort protein 2) (Nucleoprotein interactor 1) (NPI-1) Length = 538 Score = 29.3 bits (64), Expect = 9.0 Identities = 14/59 (23%), Positives = 29/59 (49%) Frame = -3 Query: 562 LCENRTEALRQRAVWAVERILRTDEIAYEISGNQNVSTALVEAFRHGDFRTRQIAERAL 386 L + E++++ A W + I + + + N+ AL+ + +FRTR+ A A+ Sbjct: 346 LLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAI 404 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,495,090 Number of Sequences: 219361 Number of extensions: 1725120 Number of successful extensions: 4526 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4510 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5196311029 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)