| Clone Name | rbags35b07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CWF17_SCHPO (O94620) Cell cycle control protein cwf17 | 33 | 0.17 | 2 | SYFB_HALSA (Q9HMK3) Phenylalanyl-tRNA synthetase beta chain (EC ... | 30 | 1.1 | 3 | SLAP2_THET8 (P35830) S-layer protein precursor (P100 protein) (S... | 28 | 7.2 |
|---|
>CWF17_SCHPO (O94620) Cell cycle control protein cwf17| Length = 340 Score = 33.1 bits (74), Expect = 0.17 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 148 YILAGSRGLDLHSYYHSHEDACLACSSDYT 237 Y+L G G H +H H+D L+CSSD T Sbjct: 304 YVLPGHEGSVNHVDFHPHQDIILSCSSDRT 333
>SYFB_HALSA (Q9HMK3) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 567 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +2 Query: 212 ALHAPPTIHPSFVDLRSAS 268 AL PPT HPSF+D R+A+ Sbjct: 510 ALETPPTTHPSFIDGRAAT 528
>SLAP2_THET8 (P35830) S-layer protein precursor (P100 protein) (Surface layer| protein) Length = 917 Score = 27.7 bits (60), Expect = 7.2 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +1 Query: 118 TNSSKAIYNAYILA-GSRGLDLHSYYHSHEDACLACSSDYTS 240 T A+Y +Y LA G L YH+ + A + SSDYT+ Sbjct: 724 TTQDIAVYGSYELALGPLTLKPMGRYHTQDAAAASTSSDYTT 765 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,146,274 Number of Sequences: 219361 Number of extensions: 959059 Number of successful extensions: 2208 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2208 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)