ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags33p14 |
|---|---|
| Clone Library Name | barley_pub |
>TPM_PERVI (Q9GZ70) Tropomyosin| Length = 284 Score = 36.2 bits (82), Expect = 0.096 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 4/90 (4%) Frame = -2 Query: 680 LQQDLIV---NLLSSMQQNEKADGAQSGTSSQVRNMQSGTV-VETSNTEKERSLLVKISE 513 L++ L V N+ + QN++A + +R++ + E TE ER+ +S+ Sbjct: 193 LEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRATEAERT----VSK 248 Query: 512 LQSRMITLTDELISAKQKHVQLQQELNALY 423 LQ + L DEL++ K+K+ + EL+A + Sbjct: 249 LQKEVDRLEDELLTEKEKYKAISDELDATF 278
>TPM_MYTGA (P91958) Tropomyosin| Length = 284 Score = 36.2 bits (82), Expect = 0.096 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 4/90 (4%) Frame = -2 Query: 680 LQQDLIV---NLLSSMQQNEKADGAQSGTSSQVRNMQSGTV-VETSNTEKERSLLVKISE 513 L++ L V N+ + QN++A + +R++ + E TE ER+ +S+ Sbjct: 193 LEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRATEAERT----VSK 248 Query: 512 LQSRMITLTDELISAKQKHVQLQQELNALY 423 LQ + L DEL++ K+K+ + EL+A + Sbjct: 249 LQKEVDRLEDELLTEKEKYKAISDELDATF 278
>TPM_MYTED (Q25457) Tropomyosin| Length = 284 Score = 34.7 bits (78), Expect = 0.28 Identities = 24/90 (26%), Positives = 47/90 (52%), Gaps = 4/90 (4%) Frame = -2 Query: 680 LQQDLIV---NLLSSMQQNEKADGAQSGTSSQVRNMQSGTV-VETSNTEKERSLLVKISE 513 L++ L V N+ + QN++A + +R++ + E TE ER+ +S+ Sbjct: 193 LEEQLTVVGANIKTLQVQNDQASQREDSYEETIRDLTNRLKDAENRATEAERT----VSK 248 Query: 512 LQSRMITLTDELISAKQKHVQLQQELNALY 423 L+ + L DEL++ K+K+ + EL+A + Sbjct: 249 LRKEVDRLEDELLTEKEKYKAISDELDATF 278
>TPM_PANST (O61379) Tropomyosin (Allergen Pan s 1) (Pan s I)| Length = 274 Score = 32.0 bits (71), Expect = 1.8 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 4/90 (4%) Frame = -2 Query: 680 LQQDLIV---NLLSSMQQNEKADGAQSGTSSQVRNMQSGTVVETSNTE-KERSLLVKISE 513 L+++L V NL S EKA+ + Q++ + + + E ERS + + Sbjct: 183 LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERS----VQK 238 Query: 512 LQSRMITLTDELISAKQKHVQLQQELNALY 423 LQ + L DEL++ K+K+ + EL+ + Sbjct: 239 LQKEVDRLEDELVNEKEKYKSITDELDQTF 268
>TPM_METEN (Q25456) Tropomyosin (Allergen Met e 1) (Met e I)| Length = 274 Score = 32.0 bits (71), Expect = 1.8 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 4/90 (4%) Frame = -2 Query: 680 LQQDLIV---NLLSSMQQNEKADGAQSGTSSQVRNMQSGTVVETSNTE-KERSLLVKISE 513 L+++L V NL S EKA+ + Q++ + + + E ERS + + Sbjct: 183 LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLTNKLKAAEARAEFAERS----VQK 238 Query: 512 LQSRMITLTDELISAKQKHVQLQQELNALY 423 LQ + L DEL++ K+K+ + EL+ + Sbjct: 239 LQKEVDRLEDELVNEKEKYKSITDELDQTF 268
>TPM_HOMAM (O44119) Tropomyosin (Allergen Hom a 1)| Length = 284 Score = 32.0 bits (71), Expect = 1.8 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 4/90 (4%) Frame = -2 Query: 680 LQQDLIV---NLLSSMQQNEKADGAQSGTSSQVRNMQSGTVVETSNTE-KERSLLVKISE 513 L+++L V NL S EKA+ + Q++ + + + E ERS + + Sbjct: 193 LEEELRVVGNNLKSLEVSEEKANQREEAYKEQIKTLANKLKAAEARAEFAERS----VQK 248 Query: 512 LQSRMITLTDELISAKQKHVQLQQELNALY 423 LQ + L DEL++ K+K+ + EL+ + Sbjct: 249 LQKEVDRLEDELVNEKEKYKSITDELDQTF 278
>TPM_LEPDS (Q9NFZ4) Tropomyosin (Allergen Lep d 10)| Length = 284 Score = 31.6 bits (70), Expect = 2.4 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 4/90 (4%) Frame = -2 Query: 680 LQQDLIV---NLLSSMQQNEKADGAQSGTSSQVRNMQSGTVVETSNTE-KERSLLVKISE 513 L+++L V NL S EKA + Q+R M + + E ERS + + Sbjct: 193 LEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAEFAERS----VQK 248 Query: 512 LQSRMITLTDELISAKQKHVQLQQELNALY 423 LQ + L DEL+ K+K+ + EL+ + Sbjct: 249 LQKEVDRLEDELVHEKEKYKSISDELDQTF 278
>TPM_HAELO (Q8IT89) Tropomyosin| Length = 284 Score = 31.6 bits (70), Expect = 2.4 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 4/90 (4%) Frame = -2 Query: 680 LQQDLIV---NLLSSMQQNEKADGAQSGTSSQVRNMQSGTVVETSNTE-KERSLLVKISE 513 L+++L V NL S EKA + Q+R M S + E ERS + + Sbjct: 193 LEEELRVVGNNLKSLEVSEEKALQKEETYEGQIRQMTSRLQEAEARAEFAERS----VQK 248 Query: 512 LQSRMITLTDELISAKQKHVQLQQELNALY 423 LQ + L DEL+ K+K+ + EL+ + Sbjct: 249 LQKEVDRLEDELVQEKEKYKAISDELDQTF 278
>TPM_DERFA (Q23939) Tropomyosin (Allergen Der f 10) (Mag44)| Length = 284 Score = 31.6 bits (70), Expect = 2.4 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 4/90 (4%) Frame = -2 Query: 680 LQQDLIV---NLLSSMQQNEKADGAQSGTSSQVRNMQSGTVVETSNTE-KERSLLVKISE 513 L+++L V NL S EKA + Q+R M + + E ERS + + Sbjct: 193 LEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAEFAERS----VQK 248 Query: 512 LQSRMITLTDELISAKQKHVQLQQELNALY 423 LQ + L DEL+ K+K+ + EL+ + Sbjct: 249 LQKEVDRLEDELVHEKEKYKSISDELDQTF 278
>TPM_DERPT (O18416) Tropomyosin (Allergen Der p 10)| Length = 284 Score = 31.2 bits (69), Expect = 3.1 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 4/90 (4%) Frame = -2 Query: 680 LQQDLIV---NLLSSMQQNEKADGAQSGTSSQVRNMQSGTVVETSNTE-KERSLLVKISE 513 L+++L V NL S EKA + Q+R M + + E ERS + + Sbjct: 193 LEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTTKLKEAEARAEFAERS----VQK 248 Query: 512 LQSRMITLTDELISAKQKHVQLQQELNALY 423 LQ + L DEL+ K+K+ + EL+ + Sbjct: 249 LQKEVGRLEDELVHEKEKYKSISDELDQTF 278
>TPM_CHIKI (O96764) Tropomyosin (Allergen Chi k 10)| Length = 285 Score = 31.2 bits (69), Expect = 3.1 Identities = 24/90 (26%), Positives = 46/90 (51%), Gaps = 4/90 (4%) Frame = -2 Query: 680 LQQDLIV---NLLSSMQQNEKADGAQSGTSSQVRNMQSGTVVETSNTE-KERSLLVKISE 513 L+++L V NL S EKA+ + +Q++ + + + E ERS + + Sbjct: 193 LEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLTTRLKEAEARAEFAERS----VQK 248 Query: 512 LQSRMITLTDELISAKQKHVQLQQELNALY 423 LQ + L DEL+S K+K+ ++ +L+ + Sbjct: 249 LQKEVDRLEDELVSEKEKYREIGDDLDTAF 278
>REXO4_ASHGO (Q757I9) RNA exonuclease 4 (EC 3.1.-.-)| Length = 285 Score = 31.2 bits (69), Expect = 3.1 Identities = 15/47 (31%), Positives = 27/47 (57%) Frame = -2 Query: 638 QNEKADGAQSGTSSQVRNMQSGTVVETSNTEKERSLLVKISELQSRM 498 ++ K+DG G ++ V + SGT ET+ K ++ KI E+ ++M Sbjct: 22 EHGKSDGKSDGKTAGVGSRASGTPPETAQRRKSKAKTSKIMEMVAKM 68
>RPN8_CANGA (Q6FMD8) 26S proteasome regulatory subunit RPN8| Length = 329 Score = 30.8 bits (68), Expect = 4.1 Identities = 25/82 (30%), Positives = 44/82 (53%), Gaps = 4/82 (4%) Frame = -2 Query: 665 IVNLLSSMQQNEKADGAQSGTSSQV----RNMQSGTVVETSNTEKERSLLVKISELQSRM 498 + NLL ++ NE+ D S TS+ + N+Q V+T+ + +++ I+ L R Sbjct: 232 VFNLLPNLGYNEETD--VSATSNDMVTASNNLQRALTVKTN----DELMVIYITNLV-RA 284 Query: 497 ITLTDELISAKQKHVQLQQELN 432 I D+LI K ++ +LQ+E N Sbjct: 285 IIAFDDLIENKMQNKKLQEERN 306
>FRIZ2_DROME (Q9VVX3) Protein frizzled-2 precursor (dFz2)| Length = 694 Score = 30.8 bits (68), Expect = 4.1 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 200 HQCVY*FLFSFFFGLIYSIGFWWVI 126 H C FL ++FFG+ SI WWVI Sbjct: 393 HSCTLVFLLTYFFGMASSI--WWVI 415
>TPM_TRISP (Q95VA8) Tropomyosin| Length = 284 Score = 30.4 bits (67), Expect = 5.3 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 4/90 (4%) Frame = -2 Query: 680 LQQDLIV---NLLSSMQQNEKADGAQSGTSSQVRNM-QSGTVVETSNTEKERSLLVKISE 513 L+++L V NL S EKA + Q+R + Q ET ERS + + Sbjct: 193 LEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRLLTQRLKEAETRAEFAERS----VQK 248 Query: 512 LQSRMITLTDELISAKQKHVQLQQELNALY 423 LQ + L DEL+ K+K+ + +EL+ + Sbjct: 249 LQKEVDRLEDELVHEKEKYKAISEELDQTF 278
>TPM_TRIPS (Q8WR63) Tropomyosin| Length = 284 Score = 30.4 bits (67), Expect = 5.3 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 4/90 (4%) Frame = -2 Query: 680 LQQDLIV---NLLSSMQQNEKADGAQSGTSSQVRNM-QSGTVVETSNTEKERSLLVKISE 513 L+++L V NL S EKA + Q+R + Q ET ERS + + Sbjct: 193 LEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRLLTQRLKEAETRAEFAERS----VQK 248 Query: 512 LQSRMITLTDELISAKQKHVQLQQELNALY 423 LQ + L DEL+ K+K+ + +EL+ + Sbjct: 249 LQKEVDRLEDELVHEKEKYKAISEELDQTF 278
>TPM_HALDV (Q9GZ71) Tropomyosin| Length = 284 Score = 30.4 bits (67), Expect = 5.3 Identities = 24/90 (26%), Positives = 45/90 (50%), Gaps = 4/90 (4%) Frame = -2 Query: 680 LQQDLIV---NLLSSMQQNEKADGAQSGTSSQVRNM-QSGTVVETSNTEKERSLLVKISE 513 L+++L V N+ S ++A + +R++ Q E TE ER+ +S+ Sbjct: 193 LEEELKVVGNNMKSLEISEQEASQREDSYEETIRDLTQRLKDAENRATEAERT----VSK 248 Query: 512 LQSRMITLTDELISAKQKHVQLQQELNALY 423 LQ + L DEL++ K+K+ + EL+ + Sbjct: 249 LQKEVDRLEDELLAEKEKYKAISDELDQTF 278
>TPM_HALRU (Q25145) Tropomyosin| Length = 284 Score = 30.0 bits (66), Expect = 6.9 Identities = 18/77 (23%), Positives = 38/77 (49%) Frame = -2 Query: 653 LSSMQQNEKADGAQSGTSSQVRNMQSGTVVETSNTEKERSLLVKISELQSRMITLTDELI 474 +S + +++ D + + ++ E TE ER+ +S+LQ + L DEL+ Sbjct: 209 ISEQEASQREDSYEETIRDLTQRLKDA---ENRATEAERT----VSKLQKEVDRLEDELL 261 Query: 473 SAKQKHVQLQQELNALY 423 + K+K+ + EL+ + Sbjct: 262 AEKEKYKAISDELDQTF 278
>TPM_BOOMI (O97162) Tropomyosin| Length = 284 Score = 30.0 bits (66), Expect = 6.9 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 4/90 (4%) Frame = -2 Query: 680 LQQDLIV---NLLSSMQQNEKADGAQSGTSSQVRNMQSGTVVETSNTE-KERSLLVKISE 513 L+++L V NL S EKA + Q+R M + + E ERS + + Sbjct: 193 LEEELRVVGNNLKSLEVSEEKALQKEETYEMQIRQMTNRLQEAEARAEFAERS----VQK 248 Query: 512 LQSRMITLTDELISAKQKHVQLQQELNALY 423 LQ + L DEL+ K+K+ + EL+ + Sbjct: 249 LQKEVDRLEDELVQEKEKYKAISDELDQTF 278
>TAF7_MOUSE (Q9R1C0) Transcription initiation factor TFIID subunit 7| (Transcription initiation factor TFIID 55 kDa subunit) (TAF(II)55) (TAFII-55) (TAFII55) Length = 341 Score = 30.0 bits (66), Expect = 6.9 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 2/74 (2%) Frame = -2 Query: 641 QQNEKADGAQSGTSSQVRNMQSGTVVETSNTEKERSLLVKISE--LQSRMITLTDELISA 468 Q+NE + G Q+ NM+ +++ L++K+ L++R + DEL Sbjct: 261 QENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDEL--- 317 Query: 467 KQKHVQLQQELNAL 426 KQK + +++L++L Sbjct: 318 KQKEDREKEQLSSL 331
>TAAR9_MOUSE (Q5QD04) Trace amine-associated receptor 9| Length = 348 Score = 30.0 bits (66), Expect = 6.9 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 580 CIFRTCDDVPDCAPSAFSFCCMLLSRF 660 C F TC D C S F CC+ + R+ Sbjct: 105 CKFHTCFDTSFCFASLFHLCCISIDRY 131
>TAAR9_RAT (Q923Y6) Trace amine-associated receptor 9 (Trace amine receptor 3)| (TaR-3) Length = 338 Score = 30.0 bits (66), Expect = 6.9 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 580 CIFRTCDDVPDCAPSAFSFCCMLLSRF 660 C F TC D C S F CC+ + R+ Sbjct: 95 CKFHTCFDTSFCFASLFHLCCISIDRY 121
>TPM_TURCO (Q7M3Y8) Tropomyosin (Major allergen Tur c 1) (Fragments)| Length = 146 Score = 30.0 bits (66), Expect = 6.9 Identities = 21/80 (26%), Positives = 39/80 (48%) Frame = -2 Query: 662 VNLLSSMQQNEKADGAQSGTSSQVRNMQSGTVVETSNTEKERSLLVKISELQSRMITLTD 483 V+L + + E A+ S Q + + + ET +R L +S+LQ + L D Sbjct: 63 VDLERAEARLEAAEAKSLEISEQEASQREDSYEETIRDLTQR--LKTVSKLQKEVDRLED 120 Query: 482 ELISAKQKHVQLQQELNALY 423 EL++ K+K+ + EL+ + Sbjct: 121 ELLAEKEKYKAISDELDQTF 140
>TAF7_HUMAN (Q15545) Transcription initiation factor TFIID subunit 7| (Transcription initiation factor TFIID 55 kDa subunit) (TAF(II)55) (TAFII-55) (TAFII55) Length = 349 Score = 30.0 bits (66), Expect = 6.9 Identities = 19/74 (25%), Positives = 38/74 (51%), Gaps = 2/74 (2%) Frame = -2 Query: 641 QQNEKADGAQSGTSSQVRNMQSGTVVETSNTEKERSLLVKISE--LQSRMITLTDELISA 468 Q+NE + G Q+ NM+ +++ L++K+ L++R + DEL Sbjct: 269 QENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDEL--- 325 Query: 467 KQKHVQLQQELNAL 426 KQK + +++L++L Sbjct: 326 KQKEDREKEQLSSL 339
>RPOB_MYCHJ (Q4A969) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1220 Score = 30.0 bits (66), Expect = 6.9 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 8/55 (14%) Frame = -2 Query: 617 AQSGTSSQVRNMQSGTVVET--------SNTEKERSLLVKISELQSRMITLTDEL 477 AQ TS +V+N + GTV++ N E+ +L+KI Q R I + D++ Sbjct: 888 AQKDTSLRVKNGEGGTVIDVQILSRDQGDNLEEGVGMLIKILIAQKRKIKVGDKM 942
>RPOB_MYCH7 (Q4A7A9) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1220 Score = 30.0 bits (66), Expect = 6.9 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 8/55 (14%) Frame = -2 Query: 617 AQSGTSSQVRNMQSGTVVET--------SNTEKERSLLVKISELQSRMITLTDEL 477 AQ TS +V+N + GTV++ N E+ +L+KI Q R I + D++ Sbjct: 888 AQKDTSLRVKNGEGGTVIDVQILSRDQGDNLEEGVGMLIKILIAQKRKIKVGDKM 942
>RPOB_MYCH2 (Q5ZZS1) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1220 Score = 30.0 bits (66), Expect = 6.9 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 8/55 (14%) Frame = -2 Query: 617 AQSGTSSQVRNMQSGTVVET--------SNTEKERSLLVKISELQSRMITLTDEL 477 AQ TS +V+N + GTV++ N E+ +L+KI Q R I + D++ Sbjct: 888 AQKDTSLRVKNGEGGTVIDVQILSRDQGDNLEEGVGMLIKILIAQKRKIKVGDKM 942
>NOTC1_BRARE (P46530) Neurogenic locus notch homolog protein 1 precursor| Length = 2437 Score = 29.6 bits (65), Expect = 9.0 Identities = 16/57 (28%), Positives = 22/57 (38%) Frame = +1 Query: 505 DCSSEILTSNDRSFSVLDVSTTVPLCIFRTCDDVPDCAPSAFSFCCMLLSRFTIRSC 675 DC + S FS ++ P C +C + C SF C+ L FT C Sbjct: 960 DCVNSYTCSCPAGFSGINCEINTPDCTESSCFNGGTCVDGISSFSCVCLPGFTGNYC 1016
>TAAR9_HUMAN (Q96RI9) Trace amine-associated receptor 9 (Trace amine receptor 3)| (TaR-3) Length = 348 Score = 29.6 bits (65), Expect = 9.0 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 580 CIFRTCDDVPDCAPSAFSFCCMLLSRF 660 C F TC D C S F CC+ + R+ Sbjct: 105 CKFHTCFDTSFCFASLFHLCCISVDRY 131 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,300,115 Number of Sequences: 219361 Number of extensions: 1430174 Number of successful extensions: 3967 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 3822 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3963 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6825954960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
