| Clone Name | rbags34e06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PEPT_LACLC (P42020) Peptidase T (EC 3.4.11.4) (Tripeptide aminop... | 29 | 8.5 | 2 | DUSC_HAEIN (P44606) tRNA-dihydrouridine synthase C (EC 1.-.-.-) | 29 | 8.5 |
|---|
>PEPT_LACLC (P42020) Peptidase T (EC 3.4.11.4) (Tripeptide aminopeptidase)| (Aminotripeptidase) (Tripeptidase) Length = 413 Score = 29.3 bits (64), Expect = 8.5 Identities = 20/76 (26%), Positives = 32/76 (42%) Frame = -2 Query: 511 ASTELGRNIDALKMXLLYAQGMLDNAQGRDIRSPALKELLHKLRELAYGADNALDELDYF 332 A T G + L+ A G + QG+++ K ++ +LA NAL E D Sbjct: 197 AYTVDGGPLGELQYETFSAAGAVIEFQGKNVHPGTAKNMMVNALQLAIDYHNALPEFDRP 256 Query: 331 RIQDELDGTYHAADLD 284 + +G +H LD Sbjct: 257 EKTEGREGFFHLLKLD 272
>DUSC_HAEIN (P44606) tRNA-dihydrouridine synthase C (EC 1.-.-.-)| Length = 310 Score = 29.3 bits (64), Expect = 8.5 Identities = 17/67 (25%), Positives = 28/67 (41%), Gaps = 3/67 (4%) Frame = +2 Query: 380 PQLVQKLLESRAADVPTLRVVQHPLCVQQXHLEGVDVAA---KLGAGCP*LQQAXRDGGQ 550 P+L + S V + QHP C+ + + +D+ + L GCP +GG Sbjct: 51 PELKNQGFTSSGTPVRVQLLGQHPKCLAENAIRAIDLGSHGIDLNCGCPSKTVNGSNGGA 110 Query: 551 RLAHHPQ 571 L P+ Sbjct: 111 ALLKQPE 117 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,800,141 Number of Sequences: 219361 Number of extensions: 1590180 Number of successful extensions: 5018 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4845 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5013 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4929664480 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)