| Clone Name | rbags34e01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LNX2_MOUSE (Q91XL2) Ligand of Numb-protein X 2 (Numb-binding pro... | 31 | 2.2 | 2 | AEX3_CAEEL (O02626) Regulator of presynaptic activity aex-3 (Abo... | 30 | 6.4 | 3 | CI010_HUMAN (Q9NZB2) Protein C9orf10 | 30 | 6.4 |
|---|
>LNX2_MOUSE (Q91XL2) Ligand of Numb-protein X 2 (Numb-binding protein 2)| Length = 687 Score = 31.2 bits (69), Expect = 2.2 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = +1 Query: 310 PGKP*PI--SRQT-VHPTGFPSSPPEHAHAIPHKESTK*LTCDE 432 PGKP P SR+ H + + PP H+ HK+ T+ +TC E Sbjct: 420 PGKPQPSNGSREAGAHSSSNHAQPPSHSRPGSHKDLTRCVTCQE 463
>AEX3_CAEEL (O02626) Regulator of presynaptic activity aex-3 (Aboc, expulsion| defective protein 3) Length = 1409 Score = 29.6 bits (65), Expect = 6.4 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = +1 Query: 307 PPGKP*PISRQTVHPTGFPSSPPEHAHA---IPHKESTK*LTCDESPSSSVHSHR 462 PP + PI ++ P G P PE A A +P + K DE+P + V +++ Sbjct: 969 PPREAPPIPKRNPPPLGAPPKVPEGARAPPPLPPRPKVKTTAVDETPQNLVPNNQ 1023
>CI010_HUMAN (Q9NZB2) Protein C9orf10| Length = 1069 Score = 29.6 bits (65), Expect = 6.4 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 4/61 (6%) Frame = -3 Query: 548 HGITWALARSK*TKTQIKMFAGYIIPP--SP--LWEWTDEEGDSSQVNYFVDSLCGMAWA 381 +G+ ++LA S+ KT+ F +PP SP + EW +G S Q V++L W Sbjct: 610 YGVLFSLAESR-KKTERLAFRKNRLPPEFSPVIIKEWAAYKGKSPQTPELVEALAFREWT 668 Query: 380 C 378 C Sbjct: 669 C 669 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,878,659 Number of Sequences: 219361 Number of extensions: 1619272 Number of successful extensions: 3732 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3732 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4815021120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)