| Clone Name | rbags34d06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GP133_HUMAN (Q6QNK2) Probable G-protein coupled receptor 133 pre... | 28 | 4.8 |
|---|
>GP133_HUMAN (Q6QNK2) Probable G-protein coupled receptor 133 precursor| (G-protein coupled receptor PGR25) Length = 874 Score = 28.5 bits (62), Expect = 4.8 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 11 LLFLHDNFVVRSTXSTAHNHPCFSNFLSSSYY 106 LL + NF VR S + +HP F S+S+Y Sbjct: 14 LLLFYYNFQVRGVYSRSQDHPGFQVLASASHY 45 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,603,597 Number of Sequences: 219361 Number of extensions: 543430 Number of successful extensions: 1414 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1414 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)