| Clone Name | rbags34b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ICAM2_HUMAN (P13598) Intercellular adhesion molecule 2 precursor... | 29 | 3.7 | 2 | MUC_CANFA (P01874) Ig mu chain C region | 28 | 6.3 |
|---|
>ICAM2_HUMAN (P13598) Intercellular adhesion molecule 2 precursor (ICAM-2)| (CD102 antigen) Length = 275 Score = 28.9 bits (63), Expect = 3.7 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = -2 Query: 160 STTCLTGS-GKRSEFLSVLLVSQEAAWKRYCP---SYDAIFVCK*YCQRKTEFISSS 2 STTC G L+ +L+ ++A WK Y S+D + C C K E ++S+ Sbjct: 49 STTCNQPEVGGLETSLNKILLDEQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSN 105
>MUC_CANFA (P01874) Ig mu chain C region| Length = 450 Score = 28.1 bits (61), Expect = 6.3 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +1 Query: 19 QSFSDNIICKRRWHHSLGSIASMPLPEILAKPTEIHSFFP 138 Q ++I+CK R H +PLP +L P E+ F P Sbjct: 79 QGTDEHIVCKVR-HSBGBKQKBVPLPVMLTLPPEVSGFIP 117 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,437,465 Number of Sequences: 219361 Number of extensions: 662229 Number of successful extensions: 1502 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1489 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1502 length of database: 80,573,946 effective HSP length: 54 effective length of database: 68,728,452 effective search space used: 1649482848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)