| Clone Name | rbags33m03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COG3_MOUSE (Q8CI04) Conserved oligomeric Golgi complex component 3 | 36 | 0.029 | 2 | COG3_HUMAN (Q96JB2) Conserved oligomeric Golgi complex component... | 35 | 0.049 | 3 | COG3_DROME (Q961G1) Putative conserved oligomeric Golgi complex ... | 33 | 0.19 |
|---|
>COG3_MOUSE (Q8CI04) Conserved oligomeric Golgi complex component 3| Length = 819 Score = 35.8 bits (81), Expect = 0.029 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = -1 Query: 288 TRLIIFKPIKTNIVEAHMQLQSLLNSEYSADEIQSI 181 T I+FKP++ NI + + +LL E+S+++IQ I Sbjct: 768 TEFILFKPVRNNIQQVFQKFHALLKEEFSSEDIQII 803
>COG3_HUMAN (Q96JB2) Conserved oligomeric Golgi complex component 3 (Vesicle| docking protein SEC34 homolog) (p94) Length = 827 Score = 35.0 bits (79), Expect = 0.049 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -1 Query: 288 TRLIIFKPIKTNIVEAHMQLQSLLNSEYSADEIQSI 181 T I+FKP++ NI + + +LL E+S ++IQ I Sbjct: 776 TEFILFKPVRNNIQQVFQKFHALLKEEFSPEDIQII 811
>COG3_DROME (Q961G1) Putative conserved oligomeric Golgi complex component 3| Length = 905 Score = 33.1 bits (74), Expect = 0.19 Identities = 14/34 (41%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = -1 Query: 288 TRLIIFKPIKTNIVEAHMQLQSLLNSE-YSADEI 190 T IIF+PI+ NI+++ ++L+ LL + YS D++ Sbjct: 771 TEFIIFRPIRNNIIQSFVKLEQLLTTNGYSTDDM 804 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,485,461 Number of Sequences: 219361 Number of extensions: 437300 Number of successful extensions: 1039 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1024 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1038 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)