| Clone Name | rbags33l13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RPOA_MESVI (Q9MUV0) DNA-directed RNA polymerase alpha chain (EC ... | 31 | 3.5 | 2 | YK55_YEAST (P36155) Hypothetical 36.1 kDa protein in SIS2-MTD1 i... | 30 | 6.0 | 3 | CATV_NPVHZ (Q8V5U0) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cys... | 30 | 7.9 |
|---|
>RPOA_MESVI (Q9MUV0) DNA-directed RNA polymerase alpha chain (EC 2.7.7.6) (PEP)| (Plastid-encoded RNA polymerase alpha subunit) (RNA polymerase alpha subunit) Length = 316 Score = 30.8 bits (68), Expect = 3.5 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +2 Query: 176 NPSNLCHY*YNTIYNTFEMDSYRINAITTENL-LKTQNYRCLLCPHCHTDNALHFSYTNE 352 NP + C Y+T N F +S +IN I E L L + Y CL HT + L +Y+ E Sbjct: 226 NPLHHCSSEYSTNKNDFSTES-KINDILVEELELSVRAYNCLKRAQIHTISDL-LAYSQE 283 Query: 353 YLYQL 367 L ++ Sbjct: 284 DLLEI 288
>YK55_YEAST (P36155) Hypothetical 36.1 kDa protein in SIS2-MTD1 intergenic| region Length = 307 Score = 30.0 bits (66), Expect = 6.0 Identities = 25/92 (27%), Positives = 45/92 (48%), Gaps = 3/92 (3%) Frame = +2 Query: 128 IVSILSFLQQDSRTELNPSNLCHY*YNTIYNTFEMDSYRINAITTENLLKTQNYRCLLCP 307 I+S + + D+ T N + ++ ++ F S I+A T LLK + ++ L P Sbjct: 8 IISYQNIMLLDNMTNYNKPAIDYF-----HHEFNDASLEISASWTL-LLKMRKHKLLRLP 61 Query: 308 HCHTDNALHFSYTNEYLYQLHQ---KRVSLGH 394 C +++ L + N YL +LH +R S+ H Sbjct: 62 SCSSEDVLDY---NMYLVRLHHCLWRRWSINH 90
>CATV_NPVHZ (Q8V5U0) Viral cathepsin (EC 3.4.22.50) (V-cath) (Cysteine| proteinase) (CP) Length = 367 Score = 29.6 bits (65), Expect = 7.9 Identities = 22/73 (30%), Positives = 36/73 (49%), Gaps = 1/73 (1%) Frame = +2 Query: 71 STTKTLAKPMPVSEALLSEI-VSILSFLQQDSRTELNPSNLCHY*YNTIYNTFEMDSYRI 247 S+ L+ P+PV L + + FLQQ +++ +P Y YN F+ + +I Sbjct: 34 SSPPPLSSPVPVLYYNLDQSEIYFKHFLQQYNKSYDDPKE-----YQYRYNVFKDNLNKI 88 Query: 248 NAITTENLLKTQN 286 N+ ENLL +N Sbjct: 89 NSQNRENLLNNKN 101 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,954,321 Number of Sequences: 219361 Number of extensions: 1844004 Number of successful extensions: 4905 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4777 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4904 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)