| Clone Name | rbaal1n18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RIN1_RAT (P97680) Ras and Rab interactor 1 (Ras interaction/inte... | 28 | 5.1 | 2 | G6PI2_COLP3 (Q483D3) Glucose-6-phosphate isomerase 2 (EC 5.3.1.9... | 28 | 8.7 |
|---|
>RIN1_RAT (P97680) Ras and Rab interactor 1 (Ras interaction/interference| protein 1) Length = 774 Score = 28.5 bits (62), Expect = 5.1 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 173 LDELQRATSLACRAGY-VTSLACNRLLFSVLFEAHLLPLN 57 + EL T L GY +TSL+ + L S L +AH LPL+ Sbjct: 562 MSELLEPTLLTGEGGYYLTSLSASLALLSGLSQAHALPLS 601
>G6PI2_COLP3 (Q483D3) Glucose-6-phosphate isomerase 2 (EC 5.3.1.9) (GPI 2)| (Phosphoglucose isomerase 2) (PGI 2) (Phosphohexose isomerase 2) (PHI 2) Length = 551 Score = 27.7 bits (60), Expect = 8.7 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +1 Query: 49 TNQFNGSK*ASNNTENKSLLHARL 120 T QFNG K NNTE +S+LH L Sbjct: 69 TGQFNGDK--INNTEGRSVLHTIL 90 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,067,416 Number of Sequences: 219361 Number of extensions: 325987 Number of successful extensions: 836 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 829 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 836 length of database: 80,573,946 effective HSP length: 38 effective length of database: 72,238,228 effective search space used: 1733717472 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)