ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags33i19 |
|---|---|
| Clone Library Name | barley_pub |
>GYRB_VIBPA (O51859) DNA gyrase subunit B (EC 5.99.1.3)| Length = 805 Score = 30.4 bits (67), Expect = 4.7 Identities = 16/62 (25%), Positives = 28/62 (45%) Frame = -3 Query: 606 YVKQQAARNQXDGAGPVKQGSMHVRVPTPDLEEAKIMETIQSELHSLKGGDGISRSFNRI 427 Y+K + A NQ + + S+HV P L + + +Q +K D +SR + R Sbjct: 546 YIKDEEAMNQYQVSLALDNASLHVNAEAPALAGEALEKLVQQYNAGIKLADRMSRRYPRA 605 Query: 426 TI 421 + Sbjct: 606 LV 607
>TRPV1_CANFA (Q697L1) Transient receptor potential cation channel subfamily V| member 1 (TrpV1) (osm-9-like TRP channel 1) (OTRPC1) (Vanilloid receptor 1) Length = 840 Score = 30.0 bits (66), Expect = 6.1 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +1 Query: 187 NSVIRIRCFTTAATTSSTDMILVEPCSQRLQCK 285 NSV+ + ++++ T + DM+LVEP ++ LQ K Sbjct: 394 NSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDK 426
>TRPV1_MOUSE (Q704Y3) Transient receptor potential cation channel subfamily V| member 1 (TrpV1) (osm-9-like TRP channel 1) (OTRPC1) (Vanilloid receptor 1) Length = 839 Score = 30.0 bits (66), Expect = 6.1 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +1 Query: 187 NSVIRIRCFTTAATTSSTDMILVEPCSQRLQCK 285 NSV+ + ++++ T + DM+LVEP ++ LQ K Sbjct: 394 NSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDK 426
>TRPV1_HUMAN (Q8NER1) Transient receptor potential cation channel subfamily V| member 1 (TrpV1) (osm-9-like TRP channel 1) (OTRPC1) (Vanilloid receptor 1) (Capsaicin receptor) Length = 839 Score = 30.0 bits (66), Expect = 6.1 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +1 Query: 187 NSVIRIRCFTTAATTSSTDMILVEPCSQRLQCK 285 NSV+ + ++++ T + DM+LVEP ++ LQ K Sbjct: 394 NSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDK 426
>TRPV1_CAVPO (Q6R5A3) Transient receptor potential cation channel subfamily V| member 1 (TrpV1) (osm-9-like TRP channel 1) (OTRPC1) (Vanilloid receptor 1) Length = 839 Score = 30.0 bits (66), Expect = 6.1 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +1 Query: 187 NSVIRIRCFTTAATTSSTDMILVEPCSQRLQCK 285 NSV+ + ++++ T + DM+LVEP ++ LQ K Sbjct: 395 NSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDK 427
>TRPV1_RAT (O35433) Transient receptor potential cation channel subfamily V| member 1 (TrpV1) (osm-9-like TRP channel 1) (OTRPC1) (Vanilloid receptor 1) (Vanilloid receptor type 1-like) (Capsaicin receptor) Length = 838 Score = 30.0 bits (66), Expect = 6.1 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +1 Query: 187 NSVIRIRCFTTAATTSSTDMILVEPCSQRLQCK 285 NSV+ + ++++ T + DM+LVEP ++ LQ K Sbjct: 393 NSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDK 425
>TRPV1_RABIT (Q6RX08) Transient receptor potential cation channel subfamily V| member 1 (TrpV1) (osm-9-like TRP channel 1) (OTRPC1) (Vanilloid receptor 1) Length = 842 Score = 30.0 bits (66), Expect = 6.1 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +1 Query: 187 NSVIRIRCFTTAATTSSTDMILVEPCSQRLQCK 285 NSV+ + ++++ T + DM+LVEP ++ LQ K Sbjct: 396 NSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDK 428 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,835,360 Number of Sequences: 219361 Number of extensions: 1559979 Number of successful extensions: 4215 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4215 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
