| Clone Name | rbags33i15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GP123_HUMAN (Q86SQ6) Probable G-protein coupled receptor 123 | 31 | 4.0 |
|---|
>GP123_HUMAN (Q86SQ6) Probable G-protein coupled receptor 123| Length = 1280 Score = 30.8 bits (68), Expect = 4.0 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 6/57 (10%) Frame = +3 Query: 369 SSICSAPFSSREPSPIISDDEPPATFSLMCTE-----PTLTTPVG-DSFTMPFACPS 521 SS+ +P SSR SP S D P T +L C P +T P G D ++CP+ Sbjct: 1161 SSLDGSPRSSRTDSPPSSLDGPAGTHTLACCTQGDPFPMVTQPEGSDGSPALYSCPT 1217 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 102,488,854 Number of Sequences: 219361 Number of extensions: 2242987 Number of successful extensions: 4726 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4723 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6769072002 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)