| Clone Name | rbags33i03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YMH5_CAEEL (P34472) Hypothetical C-type lectin protein F58A4.5 p... | 30 | 5.5 | 2 | FUMH_SCHPO (O94552) Fumarate hydratase, mitochondrial precursor ... | 30 | 9.4 |
|---|
>YMH5_CAEEL (P34472) Hypothetical C-type lectin protein F58A4.5 precursor| Length = 786 Score = 30.4 bits (67), Expect = 5.5 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +3 Query: 306 QPICILV*SNNQQIYECRSQTQNRMASHRLRICFMI 413 QPI + N ++YEC+ T N +AS L CF + Sbjct: 14 QPILVFA-QNRTELYECKIGTVNPLASTSLNACFKL 48
>FUMH_SCHPO (O94552) Fumarate hydratase, mitochondrial precursor (EC 4.2.1.2)| (Fumarase) Length = 482 Score = 29.6 bits (65), Expect = 9.4 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +2 Query: 107 PHHPNTSLHPTKRITNTYKCISYMDITIQITQHTLPIFQQLARFAK 244 P HPN ++ ++ +T+ + ++ +QI H LP + L R K Sbjct: 144 PVHPNDHVNMSQSSNDTFPTVMHIASVLQIHTHLLPAMKHLHRALK 189 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,857,891 Number of Sequences: 219361 Number of extensions: 1958549 Number of successful extensions: 4299 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4298 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7139613222 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)