| Clone Name | rbags33e19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BIRC2_MOUSE (Q62210) Baculoviral IAP repeat-containing protein 2... | 31 | 2.7 | 2 | TLR4_BOVIN (Q9GL65) Toll-like receptor 4 precursor (CD284 antigen) | 30 | 7.9 |
|---|
>BIRC2_MOUSE (Q62210) Baculoviral IAP repeat-containing protein 2 (Inhibitor of| apoptosis protein 2) (MIAP2) (MIAP-2) Length = 612 Score = 31.2 bits (69), Expect = 2.7 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +2 Query: 116 RRGLHSGENYDAPGSVHDVLFSDGDGRGEEHNRQQDPDSSSGD 244 R+ L +GENY + VL + D R EE +Q + +SGD Sbjct: 409 RQILATGENYRTVNDIVSVLLNAEDERREEEKERQTEEMASGD 451
>TLR4_BOVIN (Q9GL65) Toll-like receptor 4 precursor (CD284 antigen)| Length = 841 Score = 29.6 bits (65), Expect = 7.9 Identities = 18/87 (20%), Positives = 36/87 (41%), Gaps = 4/87 (4%) Frame = -1 Query: 430 LRSLPTDIVFDNVTGISFTCDLSDNIAAPWPXXXXXXXXXL----CAPEMSLPALPVSPL 263 L++LP + + N+T +F C W CA + + +PV Sbjct: 564 LQNLPRSLTWLNLTQNAFACVCEHQSFLQWVKDQRQLLVGAEQMMCAEPLDMEDMPVLSF 623 Query: 262 SGSSAGISRTGIGILLPVVLLTTAISI 182 ++ +S+T I + + VLL + + + Sbjct: 624 RNATCQLSKTIISVSVVTVLLVSVVGV 650 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,067,363 Number of Sequences: 219361 Number of extensions: 1669921 Number of successful extensions: 4552 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4551 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5938641176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)