| Clone Name | rbaal1n09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RCAA_HORVU (Q40073) Ribulose bisphosphate carboxylase/oxygenase ... | 81 | 8e-16 | 2 | RCA_ARATH (P10896) Ribulose bisphosphate carboxylase/oxygenase a... | 62 | 3e-10 | 3 | RCA1_LARTR (Q7X9A0) Ribulose bisphosphate carboxylase/oxygenase ... | 61 | 6e-10 | 4 | RCA_SPIOL (P10871) Ribulose bisphosphate carboxylase/oxygenase a... | 59 | 4e-09 | 5 | TFE2_XENLA (Q01978) Transcription factor E2-alpha (Transcription... | 28 | 6.0 |
|---|
>RCAA_HORVU (Q40073) Ribulose bisphosphate carboxylase/oxygenase activase A,| chloroplast precursor (RuBisCO activase A) (RA A) Length = 464 Score = 80.9 bits (198), Expect = 8e-16 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -2 Query: 218 GKGAQQGTLPVPEGCTDQNAKNYDPTARSXXGSCLYTF 105 GKGAQQGTLPVPEGCTDQNAKNYDPTARS GSCLYTF Sbjct: 427 GKGAQQGTLPVPEGCTDQNAKNYDPTARSDDGSCLYTF 464
>RCA_ARATH (P10896) Ribulose bisphosphate carboxylase/oxygenase activase,| chloroplast precursor (RuBisCO activase) (RA) Length = 474 Score = 62.4 bits (150), Expect = 3e-10 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -2 Query: 218 GKGAQQGTLPVPEGCTDQNAKNYDPTARSXXGSCLYTF 105 GKGAQQ LPVPEGCTD A+N+DPTARS G+C+Y F Sbjct: 437 GKGAQQVNLPVPEGCTDPVAENFDPTARSDDGTCVYNF 474
>RCA1_LARTR (Q7X9A0) Ribulose bisphosphate carboxylase/oxygenase activase 1,| chloroplast precursor (RuBisCO activase 1) (RA 1) (RubisCO activase alpha form) Length = 476 Score = 61.2 bits (147), Expect = 6e-10 Identities = 28/40 (70%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = -2 Query: 221 GGKGAQQ-GTLPVPEGCTDQNAKNYDPTARSXXGSCLYTF 105 GG+ AQQ G +PVPEGCTD A NYDPTARS GSC+Y F Sbjct: 437 GGQAAQQVGNVPVPEGCTDPQATNYDPTARSDDGSCVYKF 476
>RCA_SPIOL (P10871) Ribulose bisphosphate carboxylase/oxygenase activase,| chloroplast precursor (RuBisCO activase) (RA) Length = 472 Score = 58.5 bits (140), Expect = 4e-09 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -2 Query: 218 GKGAQQGTLPVPEGCTDQNAKNYDPTARSXXGSCLY 111 GK AQQ +LPV +GCTD AKNYDPTARS GSC Y Sbjct: 435 GKAAQQVSLPVAQGCTDPEAKNYDPTARSDDGSCTY 470
>TFE2_XENLA (Q01978) Transcription factor E2-alpha (Transcription factor| XE12/XE47) Length = 658 Score = 28.1 bits (61), Expect = 6.0 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = -2 Query: 278 FLLRLENSPXTPTI--SCCIGGGKGAQQGTLPVPEGCTDQNAKNYD 147 F L + N PT S GGG G ++ T P G D N +D Sbjct: 26 FPLPVANGKTRPTTLASTQFGGGSGLEERTGSAPWGTEDHNGSTFD 71 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,971,852 Number of Sequences: 219361 Number of extensions: 593022 Number of successful extensions: 1543 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1543 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)