| Clone Name | rbags33b21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YD17_SCHPO (Q10240) Hypothetical UPF0300 protein C4G9.07 in chro... | 34 | 0.29 | 2 | CAC1D_RAT (P27732) Voltage-dependent L-type calcium channel alph... | 31 | 3.3 | 3 | UL07_HHV6U (P52456) Protein U75 | 31 | 3.3 | 4 | UL07_HHV6Z (P52457) Protein U75 | 29 | 9.5 |
|---|
>YD17_SCHPO (Q10240) Hypothetical UPF0300 protein C4G9.07 in chromosome I| Length = 513 Score = 34.3 bits (77), Expect = 0.29 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = -2 Query: 239 REYQQVLENRMKCTYIQWHHLLLYHFFSIFRQSSSYAAI*AYL 111 +E ++L N + HH++LYH++ F QS+ + A+ +YL Sbjct: 232 KELSEMLTNNNAPLEVLIHHVMLYHYYPSFLQSALWTAVSSYL 274
>CAC1D_RAT (P27732) Voltage-dependent L-type calcium channel alpha-1D subunit| (Voltage-gated calcium channel alpha subunit Cav1.3) (Calcium channel, L type, alpha-1 polypeptide, isoform 2) (RAT brain class D) (RBD) Length = 2203 Score = 30.8 bits (68), Expect = 3.3 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 352 STYNFHNLILSNSKDEIKPPSSVPHQLILP 441 S++NF L NS+D++ P ++PH+ LP Sbjct: 1963 SSFNFECLRRQNSQDDVLPSPALPHRAALP 1992
>UL07_HHV6U (P52456) Protein U75| Length = 249 Score = 30.8 bits (68), Expect = 3.3 Identities = 12/31 (38%), Positives = 23/31 (74%) Frame = +3 Query: 183 MPLYVSTLHPVF*NLLVFPSNYPLTELMFDS 275 +PL STLH + L++FP+ P+T+++F++ Sbjct: 128 LPLKQSTLHKLIAKLVLFPALSPITKILFNT 158
>UL07_HHV6Z (P52457) Protein U75| Length = 249 Score = 29.3 bits (64), Expect = 9.5 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = +3 Query: 183 MPLYVSTLHPVF*NLLVFPSNYPLTELMFDS 275 +PL STLH + L++FP P+T+++F++ Sbjct: 128 LPLKQSTLHKLIARLVLFPVLSPVTKILFNT 158 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,002,001 Number of Sequences: 219361 Number of extensions: 1570559 Number of successful extensions: 3169 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3169 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5481822624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)