| Clone Name | rbags33b03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CALX_SOYBN (Q39817) Calnexin homolog precursor | 73 | 7e-13 | 2 | CALX_PEA (O82709) Calnexin homolog precursor | 71 | 2e-12 | 3 | CALX2_ARATH (Q38798) Calnexin homolog 2 precursor | 67 | 5e-11 | 4 | CALX_HELTU (Q39994) Calnexin homolog precursor | 56 | 9e-08 | 5 | CALX1_ARATH (P29402) Calnexin homolog 1 precursor | 54 | 4e-07 | 6 | SREC2_HUMAN (Q96GP6) Scavenger receptor class F member 2 precurs... | 32 | 1.9 | 7 | KRA56_HUMAN (Q6L8G9) Keratin-associated protein 5-6 (Keratin-ass... | 31 | 3.2 | 8 | ZNF77_HUMAN (Q15935) Zinc finger protein 77 (ZNFpT1) | 30 | 4.2 |
|---|
>CALX_SOYBN (Q39817) Calnexin homolog precursor| Length = 546 Score = 72.8 bits (177), Expect = 7e-13 Identities = 39/72 (54%), Positives = 49/72 (68%) Frame = -3 Query: 601 AAAESEDLSEFQKKIFSVLYKNRRTFRSWNHTRSKIIDLIEKGEKQPNITISILASVAVI 422 AA S+ +S FQKK+F +LYK H +SKI DLIEK EKQPN+TI IL +V V+ Sbjct: 427 AATGSDGISGFQKKVFDLLYKIADIPFLSEH-KSKIFDLIEKAEKQPNLTIGILVAVVVV 485 Query: 421 LVTVLFRTIFGG 386 V++ FR IFGG Sbjct: 486 FVSIFFRLIFGG 497
>CALX_PEA (O82709) Calnexin homolog precursor| Length = 551 Score = 71.2 bits (173), Expect = 2e-12 Identities = 36/73 (49%), Positives = 50/73 (68%) Frame = -3 Query: 604 AAAAESEDLSEFQKKIFSVLYKNRRTFRSWNHTRSKIIDLIEKGEKQPNITISILASVAV 425 AA +ESE ++ QKK F +LYK + + KII++IEKGEKQPN+TI I+ SV + Sbjct: 431 AARSESEGIAGIQKKAFDLLYKIA-DIAFLSGQKEKIIEIIEKGEKQPNLTIGIIVSVVI 489 Query: 424 ILVTVLFRTIFGG 386 + V++ FR IFGG Sbjct: 490 VFVSIFFRLIFGG 502
>CALX2_ARATH (Q38798) Calnexin homolog 2 precursor| Length = 532 Score = 66.6 bits (161), Expect = 5e-11 Identities = 34/93 (36%), Positives = 53/93 (56%) Frame = -3 Query: 601 AAAESEDLSEFQKKIFSVLYKNRRTFRSWNHTRSKIIDLIEKGEKQPNITISILASVAVI 422 AA E++ L +QKK+F +LYK + +SKI++LIEK E QPN+TI +L S+ ++ Sbjct: 420 AAGEADGLKSYQKKVFDLLYKVA-DISFLSAYKSKIMELIEKAETQPNLTIGVLISIVIV 478 Query: 421 LVTVLFRTIFGGXXXXXXXXXXXXXXXPSATEA 323 +++ F+ IFGG S +EA Sbjct: 479 FLSLFFKLIFGGAKAKVEKKKPETAAETSTSEA 511
>CALX_HELTU (Q39994) Calnexin homolog precursor| Length = 540 Score = 55.8 bits (133), Expect = 9e-08 Identities = 27/67 (40%), Positives = 43/67 (64%) Frame = -3 Query: 586 EDLSEFQKKIFSVLYKNRRTFRSWNHTRSKIIDLIEKGEKQPNITISILASVAVILVTVL 407 + L QK +F VLYK +H + K+++LIEK E QPNITI ++ S+ V++ ++L Sbjct: 426 DGLKGIQKAVFDVLYKIADLPFLGDH-KVKVLELIEKAETQPNITIGVIVSIIVVIFSIL 484 Query: 406 FRTIFGG 386 + +FGG Sbjct: 485 LKLLFGG 491
>CALX1_ARATH (P29402) Calnexin homolog 1 precursor| Length = 530 Score = 53.9 bits (128), Expect = 4e-07 Identities = 27/72 (37%), Positives = 44/72 (61%) Frame = -3 Query: 601 AAAESEDLSEFQKKIFSVLYKNRRTFRSWNHTRSKIIDLIEKGEKQPNITISILASVAVI 422 AA ++ L +QK +F +L K + +SKI +LIEK E+QPN+TI +L ++ V+ Sbjct: 418 AAGSADGLKSYQKVVFDLLNKVA-DLSFLSAYKSKITELIEKAEQQPNLTIGVLVAIVVV 476 Query: 421 LVTVLFRTIFGG 386 ++ + IFGG Sbjct: 477 FFSLFLKLIFGG 488
>SREC2_HUMAN (Q96GP6) Scavenger receptor class F member 2 precursor (Scavenger| receptor expressed by endothelial cells 2 protein) (SREC-II) (SRECRP-1) Length = 866 Score = 31.6 bits (70), Expect = 1.9 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = -2 Query: 443 FGLSCCHPCYCALQNHFRWQEGSGTCEA----RCCGEEAQCHGSRC 318 +G C CYC+ + Q G+ C A R C + C+ S C Sbjct: 177 WGAQCASACYCSATSRCDPQTGACLCHAGWWGRSCNNQCACNSSPC 222
>KRA56_HUMAN (Q6L8G9) Keratin-associated protein 5-6 (Keratin-associated protein| 5.6) (Ultrahigh sulfur keratin-associated protein 5.6) Length = 129 Score = 30.8 bits (68), Expect = 3.2 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -2 Query: 434 SCCHPCYCALQNHFRWQEGSGTCEARCC 351 SCC PCYC+ GS C++ CC Sbjct: 89 SCCKPCYCSSGC------GSSCCQSSCC 110
>ZNF77_HUMAN (Q15935) Zinc finger protein 77 (ZNFpT1)| Length = 545 Score = 30.4 bits (67), Expect = 4.2 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 419 CYCALQNHFRWQEGSGTCEARCCGEEAQCHGS 324 CY + ++H R G C+ + CG+ C+ S Sbjct: 307 CYSSFRDHVRTHTGEKPCQCKHCGKAFTCYSS 338 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,613,861 Number of Sequences: 219361 Number of extensions: 1145142 Number of successful extensions: 3400 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3392 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)