ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags32l23 |
|---|---|
| Clone Library Name | barley_pub |
>RIR2_TOBAC (P49730) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) (Ribonucleoside-diphosphate reductase R2 subunit) Length = 329 Score = 73.2 bits (178), Expect = 2e-13 Identities = 35/40 (87%), Positives = 35/40 (87%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMSXL 3 KLYNA PF WMELISLQGKTNFF KRVGEYQKASVMS L Sbjct: 275 KLYNAQNPFDWMELISLQGKTNFFEKRVGEYQKASVMSSL 314
>RIR2_ARATH (P50651) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) (Ribonucleoside-diphosphate reductase R2 subunit) (Protein R2at) (AtRNR2) Length = 341 Score = 65.9 bits (159), Expect = 3e-11 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMSXL 3 + Y A PF WME ISLQGKTNFF KRVGEYQKASVMS L Sbjct: 287 RTYKAENPFDWMEFISLQGKTNFFEKRVGEYQKASVMSNL 326
>RIR2_LEIAM (O46310) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) (Ribonucleotide reductase M2 subunit) Length = 345 Score = 59.7 bits (143), Expect = 2e-09 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K Y + PF +ME+ISLQGKTNFF KRVGEYQKA VMS Sbjct: 294 KHYRSTQPFDFMEMISLQGKTNFFEKRVGEYQKAGVMS 331
>RIR2_SPISO (P07201) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) (p41) Length = 384 Score = 58.5 bits (140), Expect = 5e-09 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 KLYN PF +ME ISL+GKTNFF KRVGEYQK VMS Sbjct: 331 KLYNKENPFDFMEHISLEGKTNFFEKRVGEYQKMGVMS 368
>RIR2_VACCV (P11158) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 319 Score = 58.5 bits (140), Expect = 5e-09 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K+YN PF +ME ISL+GKTNFF KRVGEYQK VMS Sbjct: 270 KIYNVTNPFDFMENISLEGKTNFFEKRVGEYQKMGVMS 307
>RIR2_VACCP (P29883) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 319 Score = 58.5 bits (140), Expect = 5e-09 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K+YN PF +ME ISL+GKTNFF KRVGEYQK VMS Sbjct: 270 KIYNVTNPFDFMENISLEGKTNFFEKRVGEYQKMGVMS 307
>RIR2_VACCC (P20493) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 319 Score = 58.5 bits (140), Expect = 5e-09 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K+YN PF +ME ISL+GKTNFF KRVGEYQK VMS Sbjct: 270 KIYNVTNPFDFMENISLEGKTNFFEKRVGEYQKMGVMS 307
>RIR2_VACCA (O57175) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 319 Score = 58.5 bits (140), Expect = 5e-09 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K+YN PF +ME ISL+GKTNFF KRVGEYQK VMS Sbjct: 270 KIYNVTNPFDFMENISLEGKTNFFEKRVGEYQKMGVMS 307
>RIR2_TRYBB (O15910) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) (Ribonucleotide reductase R2 subunit) Length = 337 Score = 58.5 bits (140), Expect = 5e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -2 Query: 116 YNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 YN+ PF +M++ISLQGKTNFF K+VGEYQKA VMS Sbjct: 288 YNSKNPFDFMDMISLQGKTNFFEKKVGEYQKAGVMS 323
>RIR2_PLAFG (P50649) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) (Ribonucleotide reductase R2 subunit) Length = 322 Score = 57.8 bits (138), Expect = 8e-09 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K++++ PF WM+LISLQGKTNFF KRV +YQK+ VM+ Sbjct: 272 KIFHSKNPFNWMDLISLQGKTNFFEKRVADYQKSGVMA 309
>RIR2_PLAF4 (P50650) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) (Ribonucleotide reductase R2 subunit) Length = 349 Score = 57.8 bits (138), Expect = 8e-09 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K++++ PF WM+LISLQGKTNFF KRV +YQK+ VM+ Sbjct: 299 KIFHSKNPFNWMDLISLQGKTNFFEKRVADYQKSGVMA 336
>RIR2_DROME (P48592) Ribonucleoside-diphosphate reductase M2 chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 393 Score = 55.5 bits (132), Expect = 4e-08 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K+YN PF +ME+ISL GKTNFF K+VGEYQ+ V+S Sbjct: 343 KIYNTKNPFNFMEMISLDGKTNFFEKKVGEYQRMGVVS 380
>RIR2_NEUCR (Q9C167) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 410 Score = 54.7 bits (130), Expect = 7e-08 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K+Y + PF +ME ISL GKTNFF KRVG+YQKA VM+ Sbjct: 347 KIYRSTNPFDFMENISLGGKTNFFEKRVGDYQKAGVMN 384
>RIR2_BRARE (P79733) Ribonucleoside-diphosphate reductase M2 subunit (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) (Ribonucleotide reductase small chain) (Ribonucleotide reductase protein R2 class I) Length = 386 Score = 54.3 bits (129), Expect = 9e-08 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K+Y PF +ME ISL+GKTNFF KRVGEYQ+ VMS Sbjct: 336 KVYRVENPFDFMENISLEGKTNFFEKRVGEYQRMGVMS 373
>RIR2_VARV (P33799) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 319 Score = 54.3 bits (129), Expect = 9e-08 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 ++YN P +ME ISL+GKTNFF KRVGEYQK VMS Sbjct: 270 RIYNVTNPSDFMENISLEGKTNFFEKRVGEYQKMGVMS 307
>RIR2_MESAU (Q60561) Ribonucleoside-diphosphate reductase M2 subunit (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) (Ribonucleotide reductase small chain) Length = 386 Score = 53.1 bits (126), Expect = 2e-07 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K++ PF +ME ISL+GKTNFF KRVGEYQ+ VMS Sbjct: 340 KIFKVENPFDFMENISLEGKTNFFEKRVGEYQRMGVMS 377
>RIR2_RAT (Q4KLN6) Ribonucleoside-diphosphate reductase M2 subunit (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) (Ribonucleotide reductase small chain) Length = 390 Score = 53.1 bits (126), Expect = 2e-07 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K++ PF +ME ISL+GKTNFF KRVGEYQ+ VMS Sbjct: 340 KIFKVENPFDFMENISLEGKTNFFEKRVGEYQRMGVMS 377
>RIR2_MOUSE (P11157) Ribonucleoside-diphosphate reductase M2 subunit (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) (Ribonucleotide reductase small chain) Length = 390 Score = 53.1 bits (126), Expect = 2e-07 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K++ PF +ME ISL+GKTNFF KRVGEYQ+ VMS Sbjct: 340 KIFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGVMS 377
>RIR2_YLDV (Q9DHU2) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 325 Score = 53.1 bits (126), Expect = 2e-07 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K Y + PF +ME ISL+GKTNFF KRV EYQK SVMS Sbjct: 275 KYYCSKNPFDFMENISLEGKTNFFEKRVSEYQKMSVMS 312
>RIR2_MACFA (Q4R7Q7) Ribonucleoside-diphosphate reductase M2 subunit (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) (Ribonucleotide reductase small chain) Length = 389 Score = 52.8 bits (125), Expect = 3e-07 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K++ PF +ME ISL+GKTNFF KRVGEYQ+ VMS Sbjct: 339 KVFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGVMS 376
>RIR2_HUMAN (P31350) Ribonucleoside-diphosphate reductase M2 subunit (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) (Ribonucleotide reductase small chain) Length = 389 Score = 52.8 bits (125), Expect = 3e-07 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K++ PF +ME ISL+GKTNFF KRVGEYQ+ VMS Sbjct: 339 KVFRVENPFDFMENISLEGKTNFFEKRVGEYQRMGVMS 376
>RIR2_YEAST (P09938) Ribonucleoside-diphosphate reductase small chain 1 (EC| 1.17.4.1) (Ribonucleotide reductase small subunit 1) (Ribonucleotide reductase R2 subunit 1) Length = 399 Score = 52.0 bits (123), Expect = 5e-07 Identities = 25/38 (65%), Positives = 27/38 (71%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K Y PF +ME ISL GKTNFF KRV +YQKA VMS Sbjct: 346 KYYKVENPFDFMENISLAGKTNFFEKRVSDYQKAGVMS 383
>RIR2B_MOUSE (Q6PEE3) Ribonucleoside-diphosphate reductase M2 subunit B (EC| 1.17.4.1) (TP53-inducible ribonucleotide reductase M2 B) (p53-inducible ribonucleotide reductase small subunit 2-like protein) (p53R2) Length = 351 Score = 51.2 bits (121), Expect = 8e-07 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K++ A PF +ME ISL+GKTNFF KRV EYQ+ +VM+ Sbjct: 301 KIFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMA 338
>RIR2B_MACFA (Q4R741) Ribonucleoside-diphosphate reductase M2 subunit B (EC| 1.17.4.1) Length = 351 Score = 51.2 bits (121), Expect = 8e-07 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K++ A PF +ME ISL+GKTNFF KRV EYQ+ +VM+ Sbjct: 301 KIFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMA 338
>RIR2B_PONPY (Q5R9G0) Ribonucleoside-diphosphate reductase M2 subunit B (EC| 1.17.4.1) Length = 351 Score = 50.8 bits (120), Expect = 1e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K++ A PF +ME ISL+GKTNFF KRV EYQ+ +VM+ Sbjct: 301 KVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMA 338
>RIR2B_HUMAN (Q7LG56) Ribonucleoside-diphosphate reductase M2 subunit B (EC| 1.17.4.1) (TP53-inducible ribonucleotide reductase M2 B) (p53-inducible ribonucleotide reductase small subunit 2-like protein) (p53R2) Length = 351 Score = 50.8 bits (120), Expect = 1e-06 Identities = 23/38 (60%), Positives = 30/38 (78%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K++ A PF +ME ISL+GKTNFF KRV EYQ+ +VM+ Sbjct: 301 KVFQAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMA 338
>RIR2_SCHPO (P36603) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 391 Score = 50.4 bits (119), Expect = 1e-06 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K YN PF +ME ISL GKTNFF K+V +YQ A VMS Sbjct: 336 KYYNVTNPFDFMENISLAGKTNFFEKKVSDYQIAGVMS 373
>RIR2_CAEEL (P42170) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 381 Score = 50.4 bits (119), Expect = 1e-06 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVM 12 KLY + PF +ME IS+ GKTNFF KRV EYQ+ VM Sbjct: 331 KLYKSKNPFDFMENISIDGKTNFFEKRVSEYQRPGVM 367
>RIR2_ENCCU (Q8SRR2) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 325 Score = 48.9 bits (115), Expect = 4e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASV 15 ++YNA PF +ME ISL GKTNFF KR +YQKA V Sbjct: 275 RVYNATNPFDFMENISLVGKTNFFDKRESQYQKAFV 310
>RIR2_RSIV (Q9QTF2) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 312 Score = 48.9 bits (115), Expect = 4e-06 Identities = 20/38 (52%), Positives = 28/38 (73%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K+YN PF +M+ IS++GKTNFF +RV EYQ+ V + Sbjct: 263 KMYNVSNPFDFMDNISIEGKTNFFERRVSEYQRMGVFT 300
>RIR2_DICDI (P42521) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 338 Score = 48.1 bits (113), Expect = 7e-06 Identities = 20/36 (55%), Positives = 26/36 (72%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASV 15 K++N+ PF WME+ISLQ K+NFF +V EY K V Sbjct: 281 KIFNSSNPFEWMEMISLQRKSNFFEGKVAEYAKTGV 316
>RIR4_YEAST (P49723) Ribonucleoside-diphosphate reductase small chain 2 (EC| 1.17.4.1) (Ribonucleotide reductase small subunit 2) (Ribonucleotide reductase R2 subunit 2) Length = 345 Score = 47.4 bits (111), Expect = 1e-05 Identities = 22/38 (57%), Positives = 27/38 (71%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASVMS 9 K YNA PF +ME ++ GKT FF K+V +YQKAS MS Sbjct: 293 KYYNAVNPFEFMEDVATAGKTTFFEKKVSDYQKASDMS 330
>RIR2_CHLMU (Q9PL92) Ribonucleoside-diphosphate reductase beta subunit (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 346 Score = 34.7 bits (78), Expect = 0.076 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -2 Query: 119 LYNAXXPFXWM-ELISLQGKTNFFXKRVGEYQKASVMS 9 +Y+ PF WM E I L + NFF RV EYQ A+ ++ Sbjct: 308 IYHTKNPFPWMSETIDLNKEKNFFETRVTEYQHAASLT 345
>RIR2_CHLPN (Q9Z6S4) Ribonucleoside-diphosphate reductase beta subunit (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 346 Score = 34.3 bits (77), Expect = 0.099 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -2 Query: 119 LYNAXXPFXWM-ELISLQGKTNFFXKRVGEYQKASVMS 9 +Y++ PF WM E + L + NFF RV EYQ A +S Sbjct: 308 IYHSRNPFPWMSETMDLNKEKNFFETRVTEYQTAGNLS 345
>RIR2_CHLTR (O84835) Ribonucleoside-diphosphate reductase beta subunit (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 346 Score = 33.9 bits (76), Expect = 0.13 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -2 Query: 119 LYNAXXPFXWM-ELISLQGKTNFFXKRVGEYQKASVMS 9 +Y+ PF WM E I L + NFF RV EYQ A+ ++ Sbjct: 308 IYHTKNPFPWMSETIDLNKEKNFFETRVIEYQHAASLT 345
>RIR2_MIMIV (Q7T6Y9) Ribonucleoside-diphosphate reductase small chain (EC| 1.17.4.1) (Ribonucleotide reductase small subunit) Length = 417 Score = 31.2 bits (69), Expect = 0.84 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -2 Query: 122 KLYNAXXPFXWMELISLQGKTNFFXKRVGEYQKASV 15 K +N PF +M+ I + K NFF KR Y A++ Sbjct: 370 KKFNVDNPFEYMKKIDVFVKANFFEKRNDAYSNANI 405 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 10,730,746 Number of Sequences: 219361 Number of extensions: 74203 Number of successful extensions: 203 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 203 length of database: 80,573,946 effective HSP length: 16 effective length of database: 77,064,170 effective search space used: 1849540080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
