| Clone Name | rbags33a22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BCL6_MOUSE (P41183) B-cell lymphoma 6 protein homolog | 32 | 0.94 | 2 | BCL6_HUMAN (P41182) B-cell lymphoma 6 protein (BCL-6) (Zinc fing... | 31 | 1.6 | 3 | ARRC_RANCA (P51481) Arrestin-C (Cone arrestin) | 29 | 6.1 | 4 | ARRC_RANPI (P51482) Arrestin-C (Cone arrestin) | 29 | 7.9 |
|---|
>BCL6_MOUSE (P41183) B-cell lymphoma 6 protein homolog| Length = 707 Score = 32.0 bits (71), Expect = 0.94 Identities = 36/134 (26%), Positives = 56/134 (41%), Gaps = 16/134 (11%) Frame = -2 Query: 448 SRARALVLPSVSLSTRINSQSMTMRSLRKRKGPS--TDYPRRSPRCMPSAAP-----MTE 290 SR LV S++ S R +S+S + + K S + P+ + C+ +A P M E Sbjct: 445 SRLNNLVNRSLAGSPRSSSESHSPLYMHPPKCTSCGSQSPQHTEMCLHTAGPTFPEEMGE 504 Query: 289 VGTAFLISVRYTG--------C**QSSAVLGKHCIQV-GDCLASV*SCQASLLHAGTVAL 137 + + S G C A L +H +Q D CQAS + G +A Sbjct: 505 TQSEYSDSSCENGTFFCNECDCRFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGNLAS 564 Query: 136 HGLMYFYTQDYRCN 95 H ++ + YRCN Sbjct: 565 HKTVHTGEKPYRCN 578
>BCL6_HUMAN (P41182) B-cell lymphoma 6 protein (BCL-6) (Zinc finger protein 51)| (LAZ-3 protein) (BCL-5) (Zinc finger and BTB domain-containing protein 27) Length = 706 Score = 31.2 bits (69), Expect = 1.6 Identities = 35/134 (26%), Positives = 56/134 (41%), Gaps = 16/134 (11%) Frame = -2 Query: 448 SRARALVLPSVSLSTRINSQSMTMRSLRKRKGPS--TDYPRRSPRCMPSAAP-----MTE 290 SR +V S++ S R +S+S + + K S + P+ + C+ +A P M E Sbjct: 444 SRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGSQSPQHAEMCLHTAGPTFPEEMGE 503 Query: 289 VGTAFLISVRYTG--------C**QSSAVLGKHCIQV-GDCLASV*SCQASLLHAGTVAL 137 + + S G C A L +H +Q D CQAS + G +A Sbjct: 504 TQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGNLAS 563 Query: 136 HGLMYFYTQDYRCN 95 H ++ + YRCN Sbjct: 564 HKTVHTGEKPYRCN 577
>ARRC_RANCA (P51481) Arrestin-C (Cone arrestin)| Length = 389 Score = 29.3 bits (64), Expect = 6.1 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 5/100 (5%) Frame = +2 Query: 8 RQRNRXSVQMSCSVRYNHA*MICVGTNPGVTSVILSVKIHQPMQGNSSC---VQQRCLA- 175 ++ + V M+C+ RY M +G + + S ++H P+ G +Q++ A Sbjct: 47 QKEKKVFVMMTCAFRYGRDDMELIGLSFRKDIYVQSCQVHPPLPGEKKALTPLQEKLKAK 106 Query: 176 -GSHTR*TISNLYAVLP*DRTALLSASGVPDGNEKCGADF 292 G ++ N+ LP ++ G D + CG DF Sbjct: 107 LGGNSFPFSFNMATNLP---CSVTLQPGPEDSGKACGVDF 143
>ARRC_RANPI (P51482) Arrestin-C (Cone arrestin)| Length = 389 Score = 28.9 bits (63), Expect = 7.9 Identities = 23/100 (23%), Positives = 43/100 (43%), Gaps = 5/100 (5%) Frame = +2 Query: 8 RQRNRXSVQMSCSVRYNHA*MICVGTNPGVTSVILSVKIHQPMQGNSSC---VQQRCLA- 175 ++ + V M+C+ RY M +G + + S ++H P+ G +Q++ A Sbjct: 47 QKEKKVFVTMTCAFRYGRDDMELIGLSFRKDIYVQSCQVHPPLPGEKKALTPLQEKLKAK 106 Query: 176 -GSHTR*TISNLYAVLP*DRTALLSASGVPDGNEKCGADF 292 G++ N+ LP ++ G D + CG DF Sbjct: 107 LGANAFPFSFNMATNLP---CSVTLQPGPEDSGKACGVDF 143 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,921,619 Number of Sequences: 219361 Number of extensions: 1404552 Number of successful extensions: 3629 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3629 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)