| Clone Name | rbags32l16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RL18_MYCGE (P47413) 50S ribosomal protein L18 | 30 | 8.7 |
|---|
>RL18_MYCGE (P47413) 50S ribosomal protein L18| Length = 115 Score = 29.6 bits (65), Expect = 8.7 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +2 Query: 407 KVRRVDMDTRVVILPYIESTYWSSHSWLYTKRCKLTLDEMIQLPLSTLNKGGAGL 571 K+R +++ RVV++ S +W ++K LT +QL L NK A L Sbjct: 17 KIRLTNLNNRVVLIVIKSLKNISVQAWDFSKNVVLTSSSSLQLKLKNGNKENAKL 71 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,577,911 Number of Sequences: 219361 Number of extensions: 1678594 Number of successful extensions: 4074 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3944 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4072 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6541540170 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)