| Clone Name | rbags32j10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PST1_SCHPO (Q09750) Paired amphipathic helix protein pst1 (SIN3 ... | 31 | 4.0 |
|---|
>PST1_SCHPO (Q09750) Paired amphipathic helix protein pst1 (SIN3 homolog 1)| Length = 1522 Score = 30.8 bits (68), Expect = 4.0 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = -1 Query: 623 YGEFVEFMKALKLKTMHIKDSLEAIAKLFSSPGRLTLLEGFRVFV 489 Y EF++ MK K + + + + ++KLF+ G L++GF F+ Sbjct: 203 YNEFLDIMKEFKSQAIETPEVITRVSKLFA--GYPNLIQGFNTFL 245 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,861,517 Number of Sequences: 219361 Number of extensions: 2101255 Number of successful extensions: 4193 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4093 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4193 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6712189044 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)