ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags32j09 |
|---|---|
| Clone Library Name | barley_pub |
>S230_PLAFO (P68875) Transmission-blocking target antigen S230 precursor| Length = 3135 Score = 28.9 bits (63), Expect = 3.1 Identities = 22/61 (36%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Frame = +3 Query: 117 HFLIYS*RSLHILHDMCNALIGMKTSDGFKNL-HFP*V--NCMNSVEFFGLASRGFSTFH 287 H YS + L D+CN IG T GF L HF NC +SV + A++ F Sbjct: 2994 HLFTYSKKPLPNDDDICNVTIGNNTFSGFACLSHFELKPNNCFSSVYDYNEANKVKKLFD 3053 Query: 288 L 290 L Sbjct: 3054 L 3054
>S230_PLAF7 (P68874) Transmission-blocking target antigen S230 precursor| Length = 3135 Score = 28.9 bits (63), Expect = 3.1 Identities = 22/61 (36%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Frame = +3 Query: 117 HFLIYS*RSLHILHDMCNALIGMKTSDGFKNL-HFP*V--NCMNSVEFFGLASRGFSTFH 287 H YS + L D+CN IG T GF L HF NC +SV + A++ F Sbjct: 2994 HLFTYSKKPLPNDDDICNVTIGNNTFSGFACLSHFELKPNNCFSSVYDYNEANKVKKLFD 3053 Query: 288 L 290 L Sbjct: 3054 L 3054
>CAC1A_MOUSE (P97445) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI) Length = 2164 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 263 FSRFFHISSLNMCNR*CHYVLXMVYF 340 +S F +S+ N R CHY+L + YF Sbjct: 1124 YSSMFILSTTNPLRRLCHYILNLRYF 1149
>CAC1A_HUMAN (O00555) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI) Length = 2505 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 263 FSRFFHISSLNMCNR*CHYVLXMVYF 340 +S F +S+ N R CHY+L + YF Sbjct: 1221 YSSMFILSTTNPLRRLCHYILNLRYF 1246
>CAC1A_RAT (P54282) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide, isoform 4) (Brain calcium channel I) (BI) (RAT brain class A) (RBA-I) Length = 2212 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 263 FSRFFHISSLNMCNR*CHYVLXMVYF 340 +S F +S+ N R CHY+L + YF Sbjct: 1172 YSSMFILSTTNPLRRLCHYILNLRYF 1197
>CAC1A_RABIT (P27884) Voltage-dependent P/Q-type calcium channel alpha-1A subunit| (Voltage-gated calcium channel alpha subunit Cav2.1) (Calcium channel, L type, alpha-1 polypeptide isoform 4) (Brain calcium channel I) (BI) Length = 2424 Score = 28.1 bits (61), Expect = 5.3 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 Query: 263 FSRFFHISSLNMCNR*CHYVLXMVYF 340 +S F +S+ N R CHY+L + YF Sbjct: 1230 YSSMFILSTTNPLRRLCHYILNLRYF 1255
>IPO8_HUMAN (O15397) Importin-8 (Imp8) (Ran-binding protein 8) (RanBP8)| Length = 1037 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 244 WNSLGLLLEVFPHFIFKYVQQMMSL 318 W LG+L EVF F+Y MM L Sbjct: 672 WQLLGILYEVFQQDCFEYFTDMMPL 696
>IPO8_MOUSE (Q7TMY7) Importin-8 (Imp8) (Ran-binding protein 8) (RanBP8)| Length = 1010 Score = 27.3 bits (59), Expect = 9.0 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 244 WNSLGLLLEVFPHFIFKYVQQMMSL 318 W LG+L EVF F+Y MM L Sbjct: 672 WQLLGILYEVFQQDCFEYFTDMMPL 696 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,624,145 Number of Sequences: 219361 Number of extensions: 1166239 Number of successful extensions: 2050 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2041 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2050 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
