| Clone Name | rbags32i24 |
|---|---|
| Clone Library Name | barley_pub |
>NLT43_HORVU (Q42842) Nonspecific lipid-transfer protein 4.3 precursor (LTP 4.3)| Length = 115 Score = 55.5 bits (132), Expect = 3e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAGIPSMCGVSVPYAISASVDCSKIR Sbjct: 90 AAGIPSMCGVSVPYAISASVDCSKIR 115
>NLT42_HORVU (Q43875) Nonspecific lipid-transfer protein 4.2 precursor (LTP 4.2)| (Low-temperature-responsive protein 4.9) Length = 115 Score = 55.5 bits (132), Expect = 3e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAGIPSMCGVSVPYAISASVDCSKIR Sbjct: 90 AAGIPSMCGVSVPYAISASVDCSKIR 115
>NLT41_HORVU (Q43767) Nonspecific lipid-transfer protein 4.1 precursor (LTP 4.1)| (CW21) (CW-21) Length = 115 Score = 55.5 bits (132), Expect = 3e-08 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAGIPSMCGVSVPYAISASVDCSKIR Sbjct: 90 AAGIPSMCGVSVPYAISASVDCSKIR 115
>NLTP8_HORVU (Q43871) Nonspecific lipid-transfer protein Cw18 precursor (LTP| Cw-18) (PKG2316) Length = 115 Score = 49.7 bits (117), Expect = 2e-06 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKI 297 AAGIPS CGVSVPY ISASVDCSKI Sbjct: 90 AAGIPSRCGVSVPYTISASVDCSKI 114
>NLTP1_ORYSA (P23096) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| (PAPI) Length = 116 Score = 45.4 bits (106), Expect = 3e-05 Identities = 19/25 (76%), Positives = 22/25 (88%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKI 297 AA IPS CGVSVPY ISAS+DCS++ Sbjct: 91 AASIPSKCGVSVPYTISASIDCSRV 115
>NLTP1_TOBAC (Q42952) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| (Pathogenesis-related protein 14) (PR-14) Length = 114 Score = 43.5 bits (101), Expect = 1e-04 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAG+PS CGV++PY IS S DCSK++ Sbjct: 89 AAGLPSTCGVNIPYKISPSTDCSKVQ 114
>NLTP5_ORYSA (O65091) Nonspecific lipid-transfer protein 5 precursor (LTP 5)| Length = 117 Score = 43.1 bits (100), Expect = 2e-04 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -2 Query: 368 AGIPSMCGVSVPYAISASVDCSKI 297 AGIPS CGV++PYAIS S DCS++ Sbjct: 93 AGIPSKCGVNIPYAISPSTDCSRV 116
>NLTP3_ORYSA (Q42999) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 117 Score = 43.1 bits (100), Expect = 2e-04 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKI 297 AA IPS CGVS+PY IS S+DCS++ Sbjct: 92 AASIPSKCGVSIPYTISPSIDCSRV 116
>NLTP1_SORBI (Q43193) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 118 Score = 42.7 bits (99), Expect = 2e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKI 297 AA IPS CGVSVPY IS S DCS++ Sbjct: 93 AASIPSKCGVSVPYTISTSTDCSRV 117
>NLTP_MAIZE (P19656) Nonspecific lipid-transfer protein precursor (LTP)| (Phospholipid transfer protein) (PLTP) (Allergen Zea m 14) Length = 120 Score = 42.4 bits (98), Expect = 3e-04 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKI 297 AA IPS CGVS+PY IS S DCS++ Sbjct: 95 AASIPSKCGVSIPYTISTSTDCSRV 119
>NLTP2_SORBI (Q43194) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 122 Score = 42.4 bits (98), Expect = 3e-04 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKI 297 AA IPS CGVS+PY IS S DCS++ Sbjct: 97 AASIPSKCGVSIPYTISTSTDCSRV 121
>NLTP2_TOBAC (Q03461) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 114 Score = 42.0 bits (97), Expect = 4e-04 Identities = 16/26 (61%), Positives = 21/26 (80%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAG+P CGV++PY IS S DCSK++ Sbjct: 89 AAGLPGACGVNIPYKISPSTDCSKVQ 114
>NLTP_ELECO (P23802) Nonspecific lipid-transfer protein (LTP) (Alpha-amylase| inhibitor I-2) Length = 95 Score = 41.2 bits (95), Expect = 6e-04 Identities = 16/25 (64%), Positives = 21/25 (84%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKI 297 A+ IP CGV +PYAISAS+DCS++ Sbjct: 69 ASSIPGRCGVRLPYAISASIDCSRV 93
>NLTP2_ORYSA (Q42978) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 118 Score = 41.2 bits (95), Expect = 6e-04 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKI 297 AA IPS CGV++PY IS S+DCS + Sbjct: 93 AASIPSKCGVTIPYTISPSIDCSSV 117
>NLTP4_ORYSA (Q42976) Nonspecific lipid-transfer protein 4 precursor (LTP 4)| Length = 121 Score = 40.8 bits (94), Expect = 8e-04 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKI 297 AA IPS CGVSV + IS SVDCSKI Sbjct: 96 AASIPSKCGVSVAFPISTSVDCSKI 120
>NLTP1_LYCES (P93224) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 114 Score = 40.4 bits (93), Expect = 0.001 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAG+P +CGV++PY IS S DCS ++ Sbjct: 89 AAGLPGVCGVNIPYKISPSTDCSTVQ 114
>NLTP_HELAN (Q39950) Nonspecific lipid-transfer protein precursor (LTP) (NsLTP)| (SDI-9) Length = 116 Score = 40.0 bits (92), Expect = 0.001 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AA P CGVS+PY IS S DCSK++ Sbjct: 91 AASFPGKCGVSIPYKISPSTDCSKVQ 116
>NLTP2_LYCES (P27056) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 114 Score = 39.7 bits (91), Expect = 0.002 Identities = 16/26 (61%), Positives = 21/26 (80%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAGIPS+C V++PY IS S DCS ++ Sbjct: 89 AAGIPSVCKVNIPYKISPSTDCSTVQ 114
>NLTP_SPIOL (P10976) Nonspecific lipid-transfer protein precursor (LTP)| (Phospholipid transfer protein) (PLTP) Length = 117 Score = 39.7 bits (91), Expect = 0.002 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKI 297 AAG+P MCGV +PYAIS S +C+ + Sbjct: 92 AAGLPGMCGVHIPYAISPSTNCNAV 116
>NLTP3_PRUDU (Q43019) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 123 Score = 39.3 bits (90), Expect = 0.002 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAG+P CGV++PY IS S DC I+ Sbjct: 98 AAGLPGKCGVNIPYKISPSTDCKSIK 123
>NLTP1_HORVU (P07597) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| (Probable amylase/protease inhibitor) Length = 117 Score = 38.9 bits (89), Expect = 0.003 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKI 297 AA IPS C V+VPY IS +DCS+I Sbjct: 92 AASIPSKCNVNVPYTISPDIDCSRI 116
>NLTP1_ARATH (Q42589) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 118 Score = 38.9 bits (89), Expect = 0.003 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAGIP CGV++PY IS S +C +R Sbjct: 93 AAGIPKACGVNIPYKISTSTNCKTVR 118
>NLTP_DAUCA (P27631) Nonspecific lipid-transfer protein precursor (LTP)| (Extracellular protein 2) Length = 120 Score = 38.5 bits (88), Expect = 0.004 Identities = 13/25 (52%), Positives = 21/25 (84%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKI 297 AAG+P+ CGV++PY IS + DC+++ Sbjct: 95 AAGLPARCGVNIPYKISPTTDCNRV 119
>NLTPB_BRAOT (Q42642) Nonspecific lipid-transfer protein B precursor (LTP B)| (Wax-associated protein 9B) Length = 117 Score = 38.5 bits (88), Expect = 0.004 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAG+P CGV++PY IS S +C+ +R Sbjct: 92 AAGLPKACGVNIPYKISKSTNCNSVR 117
>NLTP2_BRANA (Q42615) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 117 Score = 38.5 bits (88), Expect = 0.004 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAG+P CGV++PY IS S +C+ +R Sbjct: 92 AAGLPKACGVNIPYKISKSTNCNSVR 117
>NLTP1_BRANA (Q42614) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 117 Score = 38.5 bits (88), Expect = 0.004 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAG+P CGV++PY IS S +C+ +R Sbjct: 92 AAGLPKACGVNIPYKISKSTNCNSVR 117
>NLTP2_ARATH (Q9S7I3) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 118 Score = 38.5 bits (88), Expect = 0.004 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAG+PS C V++PY ISAS +C+ +R Sbjct: 93 AAGLPSACKVNIPYKISASTNCNTVR 118
>NLTP1_GOSHI (Q42762) Nonspecific lipid-transfer protein precursor (LTP)| Length = 116 Score = 38.1 bits (87), Expect = 0.005 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 A+G+P CGV++PY IS S DC+ ++ Sbjct: 91 ASGLPGKCGVNIPYKISPSTDCNSVK 116
>NLTP6_GOSHI (O24418) Nonspecific lipid-transfer protein 6 precursor (LTP)| Length = 120 Score = 38.1 bits (87), Expect = 0.005 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAG+P C V +PY IS S+DC +++ Sbjct: 95 AAGLPGQCNVHIPYKISPSIDCKRVK 120
>NLTP2_GOSHI (Q43129) Nonspecific lipid-transfer protein precursor (LTP) (GH3)| Length = 120 Score = 38.1 bits (87), Expect = 0.005 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 A+G+P CGV++PY IS S DC+ ++ Sbjct: 95 ASGLPGKCGVNIPYKISPSTDCNSVK 120
>SCA_LILLO (Q9SW93) Stigma/stylar cysteine-rich adhesin precursor (Lipid| transfer protein) Length = 113 Score = 38.1 bits (87), Expect = 0.005 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -2 Query: 368 AGIPSMCGVSVPYAISASVDCSKIR 294 AGIP CGV++PY I DC+K+R Sbjct: 89 AGIPGKCGVNIPYPIRMQTDCNKVR 113
>NLTP3_HORVU (Q43766) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| (CW20) (CW-20) (CW-19) Length = 118 Score = 38.1 bits (87), Expect = 0.005 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = -2 Query: 368 AGIPSMCGVSVPYAISASVDCSKI 297 +G+P CGVSVP+ IS S DC+K+ Sbjct: 94 SGVPGKCGVSVPFPISMSTDCNKV 117
>NLTP4_ARATH (Q9LLR6) Nonspecific lipid-transfer protein 4 precursor (LTP 4)| Length = 112 Score = 37.7 bits (86), Expect = 0.007 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 A+G+P CGVS+PY IS S +C+ I+ Sbjct: 87 ASGLPGKCGVSIPYPISTSTNCATIK 112
>NLTP_MALDO (Q9M5X7) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Mal d 3) Length = 115 Score = 37.7 bits (86), Expect = 0.007 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAG+P CGV+VPY IS S +C+ ++ Sbjct: 90 AAGLPGKCGVNVPYKISTSTNCATVK 115
>NLTP3_ARATH (Q9LLR7) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 115 Score = 37.7 bits (86), Expect = 0.007 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 A+G+P CGVS+PY IS S +C+ I+ Sbjct: 90 ASGLPGKCGVSIPYPISMSTNCNNIK 115
>NLTPA_BRAOT (Q42641) Nonspecific lipid-transfer protein A precursor (LTP A)| (Wax-associated protein 9A) Length = 118 Score = 37.4 bits (85), Expect = 0.009 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAGIP CGVSVP+ IS + +C+ ++ Sbjct: 93 AAGIPKACGVSVPFPISTNTNCNNVK 118
>NLTP1_PRUDO (P82534) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru d 3) Length = 91 Score = 37.0 bits (84), Expect = 0.012 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AA +P CGV+VPY ISAS +C+ ++ Sbjct: 66 AAALPGKCGVNVPYKISASTNCATVK 91
>NLTP1_PRUAR (P81651) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru ar 3) Length = 91 Score = 36.6 bits (83), Expect = 0.015 Identities = 13/26 (50%), Positives = 20/26 (76%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AA +P CGV++PY ISAS +C+ ++ Sbjct: 66 AAALPGKCGVNIPYKISASTNCATVK 91
>NLTP_BETVU (Q43748) Nonspecific lipid-transfer protein precursor (LTP)| Length = 117 Score = 36.6 bits (83), Expect = 0.015 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKI 297 AA +P CGVSVPYAIS + +C+ I Sbjct: 92 AASLPRQCGVSVPYAISPNTNCNAI 116
>NLTP1_WHEAT (P24296) Nonspecific lipid-transfer protein precursor (LTP)| (Phospholipid transfer protein) (PLTP) (ns-LTP1) (Fragment) Length = 113 Score = 36.2 bits (82), Expect = 0.020 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKI 297 A IP CGV++PY IS ++DCS++ Sbjct: 89 ARSIPPKCGVNLPYTISLNIDCSRV 113
>NLTP3_BRANA (Q42616) Nonspecific lipid-transfer protein 3 precursor (LTP 3)| Length = 117 Score = 36.2 bits (82), Expect = 0.020 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAG+P CGV++PY IS + +C+ ++ Sbjct: 92 AAGLPKACGVNIPYKISKTTNCNSVK 117
>NLTPD_BRAOT (Q43304) Nonspecific lipid-transfer protein D precursor (LTP D)| (Wax-associated protein 9D) Length = 118 Score = 36.2 bits (82), Expect = 0.020 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AAG+P CGV++PY IS + +C+ ++ Sbjct: 93 AAGLPKACGVNIPYKISKTTNCNSVK 118
>NLTP1_PRUPE (P81402) Nonspecific lipid-transfer protein 1 (LTP 1) (Major| allergen Pru p 3) (Pru p 1) Length = 91 Score = 35.8 bits (81), Expect = 0.026 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AA +P CGV +PY ISAS +C+ ++ Sbjct: 66 AAALPGKCGVHIPYKISASTNCATVK 91
>NLTP_PRUAV (Q9M5X8) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Pru av 3) Length = 117 Score = 35.0 bits (79), Expect = 0.044 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AA +P CGV+VPY IS S +C+ ++ Sbjct: 92 AAALPGKCGVNVPYKISPSTNCATVK 117
>NLTP1_PRUDU (Q43017) Nonspecific lipid-transfer protein 1 precursor (LTP 1)| Length = 117 Score = 35.0 bits (79), Expect = 0.044 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AA +P CGV++PY IS S +C+ ++ Sbjct: 92 AAALPGKCGVNIPYQISPSTNCANVK 117
>NLTP_GERHY (Q39794) Nonspecific lipid-transfer protein precursor (LTP)| Length = 116 Score = 33.5 bits (75), Expect = 0.13 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKI 297 A +P CG+S+ Y I+ ++DCSKI Sbjct: 91 ANSLPGKCGISIGYKITPNIDCSKI 115
>NLTP_PYRCO (Q9M5X6) Nonspecific lipid-transfer protein precursor (LTP)| (Allergen Pyr c 3) Length = 115 Score = 33.5 bits (75), Expect = 0.13 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 A +P CGV+VPY IS S +C+ ++ Sbjct: 90 AESLPGKCGVNVPYKISTSTNCATVK 115
>NLTP1_PHAAU (P83434) Nonspecific lipid-transfer protein 1 (LTP 1) (NS-LTP1)| Length = 91 Score = 33.1 bits (74), Expect = 0.17 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKI 297 A +P CGV++PY IS S +C+ I Sbjct: 66 AEALPGKCGVNIPYKISTSTNCNSI 90
>NLTP6_ARATH (Q9LDB4) Nonspecific lipid-transfer protein 6 precursor (LTP 6)| Length = 113 Score = 32.7 bits (73), Expect = 0.22 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 A +PS CGV +PY S S DC I+ Sbjct: 88 ALELPSKCGVDLPYKFSPSTDCDSIQ 113
>SPT6H_CAEEL (P34703) Suppressor of Ty 6 homolog (Abnormal embryogenesis protein| 5) Length = 1521 Score = 30.4 bits (67), Expect = 1.1 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = -1 Query: 273 IAPAIDAEYVEVTHTYIYMN-KCSHIIFMWDIYRERQRERGRSIYVEPVLHGRP 115 + P I + TH Y + N C + RE++RE GRS YV + +P Sbjct: 1384 VQPMIQISHEITTHKYFFPNGTCEETEAVEQFVREKKRELGRSPYVFSASYRQP 1437
>NLTP_AMACA (P80450) Nonspecific lipid-transfer protein (LTP) (Phospholipid| transfer protein) (PLTP) Length = 94 Score = 28.9 bits (63), Expect = 3.2 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AA + S CGV + Y++S +V+C+ ++ Sbjct: 69 AARLASQCGVRMSYSVSPNVNCNSVQ 94
>NLTP1_AMAHP (P83167) Nonspecific lipid-transfer protein 1 (LTP 1) (NS-LTP1)| Length = 94 Score = 28.9 bits (63), Expect = 3.2 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = -2 Query: 371 AAGIPSMCGVSVPYAISASVDCSKIR 294 AA + S CGV + Y++S +V+C+ ++ Sbjct: 69 AARLASQCGVRMSYSVSPNVNCNSVQ 94
>ATP7A_CRIGR (P49015) Copper-transporting ATPase 1 (EC 3.6.3.4) (Copper pump 1)| (Fragment) Length = 1476 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = -2 Query: 236 HIHTYI*INALILSSCGIYIERDREREDGVSMLSQFCMAG 117 H YI ++ + +SC IER+ RE+G+ + MAG Sbjct: 477 HSKCYIQVSGMTCASCVANIERNLRREEGIYSVLVALMAG 516
>SYI_YERPS (Q66ES4) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 938 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 186 DIYRERQRERGRSIYVEPVLHGRPYCSIH 100 D+ E RE+G ++VE +LH P C H Sbjct: 381 DVVVELLREKGALLHVEKLLHSYPCCWRH 409
>SYI_YERPE (Q8ZIM0) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 938 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 186 DIYRERQRERGRSIYVEPVLHGRPYCSIH 100 D+ E RE+G ++VE +LH P C H Sbjct: 381 DVVVELLREKGALLHVEKLLHSYPCCWRH 409
>ATP7A_HUMAN (Q04656) Copper-transporting ATPase 1 (EC 3.6.3.4) (Copper pump 1)| (Menkes disease-associated protein) Length = 1500 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -2 Query: 224 YI*INALILSSCGIYIERDREREDGVSMLSQFCMAG 117 YI + + +SC IER+ RE+G+ + MAG Sbjct: 491 YIQVTGMTCASCVANIERNLRREEGIYSILVALMAG 526
>RPOC2_CHAGL (Q8MA10) DNA-directed RNA polymerase beta'' chain (EC 2.7.7.6)| (PEP) (Plastid-encoded RNA polymerase beta'' subunit) (RNA polymerase beta'' subunit) Length = 1373 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 19 FIYPTVHMVQNTINSWVPSKGVK 87 +IY +H VQNT + WV S +K Sbjct: 460 YIYSNLHTVQNTGHIWVVSGNIK 482
>ATP7A_RAT (P70705) Copper-transporting ATPase 1 (EC 3.6.3.4) (Copper pump 1)| (Menkes disease-associated protein homolog) Length = 1492 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -2 Query: 224 YI*INALILSSCGIYIERDREREDGVSMLSQFCMAG 117 YI ++ + +SC IER+ RE+G+ + MAG Sbjct: 483 YIQVSGMTCASCVANIERNLRREEGIYSVLVALMAG 518
>KPPR_SPIOL (P09559) Phosphoribulokinase, chloroplast precursor (EC 2.7.1.19)| (Phosphopentokinase) (PRKase) (PRK) Length = 402 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -1 Query: 267 PAIDAEYVEVTHTYIYMNKCSHIIFMWDIYRERQRERGRSI 145 P DA E+ IY++ + + F W I R+ +ERG S+ Sbjct: 180 PMYDARVRELLDFSIYLDISNEVKFAWKIQRD-MKERGHSL 219
>GPMI_METMA (Q8PYF8) 2,3-bisphosphoglycerate-independent phosphoglycerate| mutase (EC 5.4.2.1) (Phosphoglyceromutase) (BPG-independent PGAM) (iPGM) Length = 521 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 202 MRAFIHIYVCMCDLNVLSVDCWGYRQQVVDQRILEQSTEAL 324 MR +H+ L ++ +D WGYR++ IL ST L Sbjct: 1 MRISLHMTQARRPLMLMILDGWGYREEKEGNAILAASTPHL 41 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,913,756 Number of Sequences: 219361 Number of extensions: 943304 Number of successful extensions: 2445 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 2418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2444 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)