ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags32h19 |
|---|---|
| Clone Library Name | barley_pub |
>FKB70_WHEAT (Q43207) 70 kDa peptidyl-prolyl isomerase (EC 5.2.1.8)| (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) Length = 559 Score = 129 bits (325), Expect = 5e-30 Identities = 65/66 (98%), Positives = 66/66 (100%) Frame = -2 Query: 621 YTQLADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTRPS 442 YTQLADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMT+PS Sbjct: 494 YTQLADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTKPS 553 Query: 441 AEESKA 424 AEESKA Sbjct: 554 AEESKA 559
>FKB70_ARATH (Q38931) 70 kDa peptidyl-prolyl isomerase (EC 5.2.1.8)| (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) (Peptidylprolyl isomerase ROF1) Length = 551 Score = 86.3 bits (212), Expect = 7e-17 Identities = 39/58 (67%), Positives = 50/58 (86%) Frame = -2 Query: 621 YTQLADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTR 448 Y +L+DL+LAE D+KKALEIDP NR+VKL K LKEK+KE NKK+AKFY NMF+K+++ Sbjct: 493 YMELSDLDLAEFDVKKALEIDPNNREVKLEQKRLKEKMKEFNKKEAKFYGNMFAKLSK 550
>FKBP5_MOUSE (Q64378) FK506-binding protein 5 (EC 5.2.1.8) (Peptidyl-prolyl| cis-trans isomerase) (PPIase) (Rotamase) (51 kDa FK506-binding protein) (FKBP-51) Length = 456 Score = 50.1 bits (118), Expect = 5e-06 Identities = 23/65 (35%), Positives = 37/65 (56%) Frame = -2 Query: 606 DLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTRPSAEESK 427 D E A+ D +K L ++P+NR +L + K KE N++D + Y+NMF K A+E Sbjct: 366 DFESAKGDFEKVLAVNPQNRAARLQISMCQRKAKEHNERDRRVYANMFKKFAERDAKEEA 425 Query: 426 A*TGA 412 + G+ Sbjct: 426 SKAGS 430
>FKBP5_PONPY (Q5RF88) FK506-binding protein 5 (EC 5.2.1.8) (Peptidyl-prolyl| cis-trans isomerase) (PPIase) (Rotamase) Length = 457 Score = 49.7 bits (117), Expect = 7e-06 Identities = 21/58 (36%), Positives = 36/58 (62%) Frame = -2 Query: 606 DLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTRPSAEE 433 + E A+ D +K LE++P+N+ +L ++K KE N++D + Y+NMF K A+E Sbjct: 366 EFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKE 423
>FKBP5_HUMAN (Q13451) FK506-binding protein 5 (EC 5.2.1.8) (Peptidyl-prolyl| cis-trans isomerase) (PPIase) (Rotamase) (51 kDa FK506-binding protein) (FKBP-51) (54 kDa progesterone receptor-associated immunophilin) (FKBP54) (P54) (FF1 antigen) (HSP90-bindin Length = 457 Score = 49.7 bits (117), Expect = 7e-06 Identities = 21/58 (36%), Positives = 36/58 (62%) Frame = -2 Query: 606 DLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTRPSAEE 433 + E A+ D +K LE++P+N+ +L ++K KE N++D + Y+NMF K A+E Sbjct: 366 EFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKE 423
>FKBP5_CERAE (Q95L05) FK506-binding protein 5 (EC 5.2.1.8) (Peptidyl-prolyl| cis-trans isomerase) (51 kDa FK506-binding immunophilin) (FKBP-51) Length = 457 Score = 49.7 bits (117), Expect = 7e-06 Identities = 21/58 (36%), Positives = 36/58 (62%) Frame = -2 Query: 606 DLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTRPSAEE 433 + E A+ D +K LE++P+N+ +L ++K KE N++D + Y+NMF K A+E Sbjct: 366 EFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKE 423
>FKBP5_SAGOE (Q9XSI2) FK506-binding protein 5 (EC 5.2.1.8) (Peptidyl-prolyl| cis-trans isomerase) (51 kDa FK506-binding immunophilin) (FKBP-51) Length = 457 Score = 49.3 bits (116), Expect = 9e-06 Identities = 21/58 (36%), Positives = 36/58 (62%) Frame = -2 Query: 606 DLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTRPSAEE 433 + E A+ D +K LE++P+N+ +L ++K KE N++D + Y+NMF K A+E Sbjct: 366 EFESAKGDFEKVLEVNPQNKAARLQIVVCQKKAKEHNERDRRIYANMFKKFAEQDAKE 423
>FKBP5_AOTNA (Q9XT11) FK506-binding protein 5 (EC 5.2.1.8) (Peptidyl-prolyl| cis-trans isomerase) (51 kDa FK506-binding immunophilin) (FKBP-51) Length = 457 Score = 48.5 bits (114), Expect = 2e-05 Identities = 21/58 (36%), Positives = 36/58 (62%) Frame = -2 Query: 606 DLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTRPSAEE 433 + E A+ D +K LE++P+N+ +L ++K KE N++D + Y+NMF K A+E Sbjct: 366 EFESAKGDFEKVLEVNPQNKAARLQIFMCQKKAKEHNERDRRIYANMFKKFAEQDAKE 423
>FKBP5_SAIBB (Q9XSH5) FK506-binding protein 5 (EC 5.2.1.8) (Peptidyl-prolyl| cis-trans isomerase) (51 kDa FK506-binding immunophilin) (FKBP-51) Length = 457 Score = 47.8 bits (112), Expect = 3e-05 Identities = 21/58 (36%), Positives = 36/58 (62%) Frame = -2 Query: 606 DLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTRPSAEE 433 + E A+ D +K LE++P+N+ +L ++K KE N++D + Y+NMF K A+E Sbjct: 366 EFESAKGDFEKVLEVNPQNKAARLQIFMCQKKAKEHNERDRRTYANMFKKFAEQDAKE 423
>FKBP4_HUMAN (Q02790) FK506-binding protein 4 (EC 5.2.1.8) (Peptidyl-prolyl| cis-trans isomerase) (PPIase) (Rotamase) (p59 protein) (HSP-binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506-binding protein) (FKBP59) Length = 458 Score = 41.6 bits (96), Expect = 0.002 Identities = 20/61 (32%), Positives = 35/61 (57%) Frame = -2 Query: 606 DLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTRPSAEESK 427 D ELA D +K L++ P N+ K +++I+ ++ K Y+NMF ++ + EE+K Sbjct: 367 DFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERL---AEEENK 423 Query: 426 A 424 A Sbjct: 424 A 424
>FKBP4_RABIT (P27124) FK506-binding protein 4 (EC 5.2.1.8) (Peptidyl-prolyl| cis-trans isomerase) (PPIase) (Rotamase) (p59 protein) (HSP-binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506-binding protein) (FKBP59) Length = 457 Score = 40.8 bits (94), Expect = 0.003 Identities = 19/61 (31%), Positives = 36/61 (59%) Frame = -2 Query: 606 DLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTRPSAEESK 427 D +LA D +K L++ P N+ K +++I++ ++ K Y+NMF ++ + EE+K Sbjct: 367 DFDLARADFQKVLQLYPSNKAAKAQLAVCQQRIRKQIAREKKLYANMFERL---AEEENK 423 Query: 426 A 424 A Sbjct: 424 A 424
>FKB59_DROME (Q9VL78) FK506-binding protein 59 (EC 5.2.1.8) (Peptidyl-prolyl| cis-trans isomerase) (PPIase) (Rotamase) (dFKBP59) Length = 439 Score = 40.4 bits (93), Expect = 0.004 Identities = 19/57 (33%), Positives = 32/57 (56%) Frame = -2 Query: 606 DLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTRPSAE 436 +LE A D +K ++++P N+ K+K+KE K+ K Y+NMF+K+ E Sbjct: 346 ELEDALEDFQKVIQLEPGNKAAANQVIICKQKLKESKNKEKKLYANMFTKLAANDKE 402
>PPID_BOVIN (P26882) 40 kDa peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-40) (CYP-40) (Cyclophilin-related protein) (Estrogen receptor-binding cyclophilin) Length = 369 Score = 36.6 bits (83), Expect = 0.061 Identities = 18/51 (35%), Positives = 30/51 (58%) Frame = -2 Query: 612 LADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFS 460 L + + A D+KKA EI PE++ ++ +K+KIK K+ Y+ MF+ Sbjct: 319 LKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKIKAQKDKEKAAYAKMFA 369
>FKBP4_MOUSE (P30416) FK506-binding protein 4 (EC 5.2.1.8) (Peptidyl-prolyl| cis-trans isomerase) (PPIase) (Rotamase) (p59 protein) (HSP-binding immunophilin) (HBI) (FKBP52 protein) (52 kDa FK506-binding protein) (FKBP59) Length = 457 Score = 36.2 bits (82), Expect = 0.080 Identities = 14/51 (27%), Positives = 28/51 (54%) Frame = -2 Query: 606 DLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKM 454 D +LA D +K L++ P N+ K +++ + ++ K Y+NMF ++ Sbjct: 367 DFDLARADFQKVLQLYPSNKAAKTQLAVCQQRTRRQLAREKKLYANMFERL 417
>PPID_HUMAN (Q08752) 40 kDa peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-40) (CYP-40) (Cyclophilin-related protein) Length = 369 Score = 34.3 bits (77), Expect = 0.30 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = -2 Query: 612 LADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFS 460 L + + A D+KKA I PE++ ++ +K+KIK K+ Y+ MF+ Sbjct: 319 LKEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA 369
>SGTB_HUMAN (Q96EQ0) Small glutamine-rich tetratricopeptide repeat-containing| protein B (Small glutamine-rich protein with tetratricopeptide repeats 2) Length = 304 Score = 32.7 bits (73), Expect = 0.88 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -2 Query: 618 TQLADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEIN 496 T L E A +KAL++DPEN K K ++K++E++ Sbjct: 164 TALNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVS 204
>PPID_USTMA (Q4P0V4) Peptidyl-prolyl cis-trans isomerase D (EC 5.2.1.8) (PPIase| D) (Rotamase D) Length = 398 Score = 32.3 bits (72), Expect = 1.2 Identities = 21/54 (38%), Positives = 26/54 (48%) Frame = -2 Query: 621 YTQLADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFS 460 Y D E AE D+K ALE PE+ VK + L + + K YS MFS Sbjct: 345 YVAQKDDERAEADLKHALENAPEDAGVKRELQALARRKEAKLKGMRAAYSKMFS 398
>SGTB_MOUSE (Q8VD33) Small glutamine-rich tetratricopeptide repeat-containing| protein B Length = 304 Score = 32.0 bits (71), Expect = 1.5 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -2 Query: 618 TQLADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEIN 496 T + E A +KAL++DPEN K K ++K++E++ Sbjct: 164 TAMNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQKLREVS 204
>PPID_RAT (Q6DGG0) 40 kDa peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-40) (CYP-40) Length = 369 Score = 32.0 bits (71), Expect = 1.5 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = -2 Query: 612 LADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFS 460 L + + A D+KKA EI P ++ ++ +K+ IK K+ Y+ MF+ Sbjct: 319 LKEYDQALADLKKAQEIAPGDKAIQAELLKVKQMIKAQKDKEKAVYAKMFA 369
>PPID_MOUSE (Q9CR16) 40 kDa peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)| (PPIase) (Rotamase) (Cyclophilin-40) (CYP-40) Length = 369 Score = 32.0 bits (71), Expect = 1.5 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = -2 Query: 612 LADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFS 460 L + + A D+KKA EI P ++ ++ +K+ IK K+ Y+ MF+ Sbjct: 319 LKEYDQALADLKKAQEIAPGDKAIQAELLKVKQMIKAQKDKEKAVYAKMFA 369
>SOLR_CLOAB (P33746) Sol locus transcriptional repressor| Length = 318 Score = 31.2 bits (69), Expect = 2.6 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = -2 Query: 621 YTQLADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYS 472 Y ++ D + +E +KKAL+ +PE + + LK K +I K AK Y+ Sbjct: 176 YAKIGDYKKSEEYLKKALDAEPEKPSTHIYFSYLKRKTNDI--KLAKEYA 223
>PPID_CRYNE (Q5KFV5) Peptidyl-prolyl cis-trans isomerase D (EC 5.2.1.8) (PPIase| D) (Rotamase D) Length = 375 Score = 29.6 bits (65), Expect = 7.5 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = -2 Query: 621 YTQLADLELAEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMF 463 Y D E AE D+K ALE P + V K ++ K K +K+ + ++ MF Sbjct: 322 YVLKKDDEAAEKDLKGALECVPGDAGVIKLLKDVEAKRKARREKERQAFAKMF 374
>PPID_AMAMU (Q5U8Z7) Peptidyl-prolyl cis-trans isomerase D (EC 5.2.1.8) (PPIase| D) (Rotamase D) Length = 371 Score = 29.6 bits (65), Expect = 7.5 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = -2 Query: 594 AEVDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFS 460 AE D+K A E+ PE+ + + +K KE +++ K Y MF+ Sbjct: 327 AEQDLKTANELLPEDGAIAAELAKIIQKKKEQREREKKAYKKMFA 371
>SYF2_EMENI (Q5BC69) Pre-mRNA-splicing factor syf2| Length = 297 Score = 29.3 bits (64), Expect = 9.8 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = -2 Query: 612 LADLELAE-VDIKKALEIDPENRDVKLTYKTLKEKIKEINKKDAKFYSNMFSKMTRPSAE 436 +ADL AE V +KK + + D +TY + EK K+ N+K A+FY N ++ R S E Sbjct: 236 VADLRKAEEVRLKKRRDRRGGDEDGDVTY--INEKNKQFNQKLARFY-NKYTTEIRDSFE 292
>TIG_PROMA (Q7V9L7) Trigger factor (TF)| Length = 467 Score = 29.3 bits (64), Expect = 9.8 Identities = 14/35 (40%), Positives = 25/35 (71%), Gaps = 2/35 (5%) Frame = -2 Query: 594 AEVDIKKALEIDP--ENRDVKLTYKTLKEKIKEIN 496 AE+++KK L ++ E ++K+ + L+EKIKE+N Sbjct: 363 AEINLKKNLALNALAEAENIKVDSQALEEKIKEVN 397 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,311,219 Number of Sequences: 219361 Number of extensions: 1681260 Number of successful extensions: 4437 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 4314 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4434 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
