| Clone Name | rbaal1m19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HMSH_DROME (Q03372) Muscle segmentation homeobox (Protein drop) ... | 28 | 6.6 | 2 | ADA20_HUMAN (O43506) ADAM 20 precursor (EC 3.4.24.-) (A disinteg... | 28 | 8.6 |
|---|
>HMSH_DROME (Q03372) Muscle segmentation homeobox (Protein drop) (Protein msh)| Length = 515 Score = 28.5 bits (62), Expect = 6.6 Identities = 32/118 (27%), Positives = 50/118 (42%), Gaps = 5/118 (4%) Frame = +1 Query: 1 GPNTLPVNITFGSISTIYIHNSTMINCTYTPSITLARA*FKT*YSS*ALFINHCHRL--D 174 G N N+T +++ + + +N +P+ S AL + H L Sbjct: 48 GSNMSSGNMTSSNLTNLSPSHPAGLNALASPT------------SPSALLLAHQQHLLQQ 95 Query: 175 YQQH*SGKGRETQQYKRKI*LLMLFKVSQSAIHLHQLXSRLNG---CSS*ADFRLRFP 339 +QQH ++ QQ +++ L L V A HLH+ SRL+ S AD R R P Sbjct: 96 HQQH-----QQQQQQQQQAAALQLAAVHPPAHHLHKTTSRLSNFSVASLLADTRPRTP 148
>ADA20_HUMAN (O43506) ADAM 20 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 20) Length = 726 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 141 LARVLGFELGPS*SNRWCICTIDHCAVMYVY 49 L LG LG +WC+C + C +M+ Y Sbjct: 340 LGHELGHNLGMQHDTQWCVCELQWC-IMHAY 369 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,838,910 Number of Sequences: 219361 Number of extensions: 781279 Number of successful extensions: 1383 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1383 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)