| Clone Name | rbags31p06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YAQ5_SCHPO (Q10105) Putative translational activator C18G6.05c (... | 45 | 3e-04 | 2 | GCN1_YEAST (P33892) Translational activator GCN1 | 40 | 0.009 | 3 | HEATR_CAEEL (Q23495) Hypothetical protein ZK430.1 in chromosome II | 30 | 9.0 | 4 | Y5738_STRCO (O86835) Hypothetical zinc protease SCO5738 (EC 3.4.... | 30 | 9.0 | 5 | NUP93_MOUSE (Q8BJ71) Nuclear pore complex protein Nup93 (Nucleop... | 30 | 9.0 |
|---|
>YAQ5_SCHPO (Q10105) Putative translational activator C18G6.05c (GCN1 homolog)| Length = 2670 Score = 44.7 bits (104), Expect = 3e-04 Identities = 24/62 (38%), Positives = 38/62 (61%) Frame = -3 Query: 544 SSTEVRRRSLSCIKAAAKINHSALATHISILGPAIGDTLKDSSSPVRIAAERCAVHVFQL 365 +S + RR +L I+ +K N+S + HISIL PAI ++ PV++AAE + +FQL Sbjct: 2538 TSQDSRRLALLIIRVVSKENYSLIKPHISILAPAIFGCVRAIVIPVKLAAEAAFLALFQL 2597 Query: 364 TK 359 + Sbjct: 2598 VE 2599
>GCN1_YEAST (P33892) Translational activator GCN1| Length = 2672 Score = 39.7 bits (91), Expect = 0.009 Identities = 19/66 (28%), Positives = 39/66 (59%), Gaps = 1/66 (1%) Frame = -3 Query: 544 SSTEVRRRSLSCIKAAAKINHS-ALATHISILGPAIGDTLKDSSSPVRIAAERCAVHVFQ 368 +ST+VRR +L I+ A+ + + ++GP++ L+D P+++AAE+ + +F+ Sbjct: 2525 NSTDVRRLALVVIRTLARFKFDECIKQYFDVVGPSVFSCLRDPVIPIKLAAEKAYLALFK 2584 Query: 367 LTKGAD 350 L + D Sbjct: 2585 LVEEDD 2590
>HEATR_CAEEL (Q23495) Hypothetical protein ZK430.1 in chromosome II| Length = 1650 Score = 29.6 bits (65), Expect = 9.0 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = -3 Query: 550 RDSSTEVRRRSLSCIKAAAKINHSALATHISILGPAIGDTLKDSSSPVRIAAER 389 RDS ++R R+L ++ K + H+SIL P + + ++D + V ++ Sbjct: 1577 RDSRAKIRYRALIVLELLIKEIGDGVQPHLSILLPFLNELIEDENKQVEAQCQK 1630
>Y5738_STRCO (O86835) Hypothetical zinc protease SCO5738 (EC 3.4.99.-)| Length = 459 Score = 29.6 bits (65), Expect = 9.0 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = -1 Query: 666 MTSSLFVKPLRKLWGGYSVTSYNSGAAPCNLF 571 M+S LF + K YSV SY SG A C LF Sbjct: 307 MSSRLFQEVREKRGLAYSVYSYTSGFADCGLF 338
>NUP93_MOUSE (Q8BJ71) Nuclear pore complex protein Nup93 (Nucleoporin Nup93) (93| kDa nucleoporin) (CBP-interacting protein 4) Length = 819 Score = 29.6 bits (65), Expect = 9.0 Identities = 22/66 (33%), Positives = 36/66 (54%) Frame = +2 Query: 314 HVGEMLLRSGNIICPFGQLENMDGTALCSYTYW*TTILQSITNCRAQYRDMCSKSGMIYL 493 ++ E+LL + NI+ F Q + + GT+ S T I + R+Q R + + +GMI Sbjct: 744 NLSEVLLATMNIL--FTQFKRLKGTSPSSATRPQRVIEDRDSQLRSQARALITFAGMIPY 801 Query: 494 RSSFDT 511 R+S DT Sbjct: 802 RTSGDT 807 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,711,718 Number of Sequences: 219361 Number of extensions: 1875097 Number of successful extensions: 4273 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4273 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6825954960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)