| Clone Name | rbags31n24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LNT_RHILO (Q98BJ6) Apolipoprotein N-acyltransferase (EC 2.3.1.-)... | 30 | 2.3 | 2 | SYA_LEGPL (Q5WVQ2) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine-... | 29 | 3.9 | 3 | HRP3_SCHPO (O14139) Chromodomain helicase hrp3 (EC 3.6.1.-) (ATP... | 29 | 3.9 |
|---|
>LNT_RHILO (Q98BJ6) Apolipoprotein N-acyltransferase (EC 2.3.1.-) (ALP| N-acyltransferase) Length = 530 Score = 29.6 bits (65), Expect = 2.3 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = -2 Query: 166 WGW--GIIATXXLP*FFFLRHCIAIIGLAVYGFWRACFTMLP 47 WGW ++A FL +A++G A Y F+ ACF P Sbjct: 12 WGWRRALVA--------FLAGALAVLGQAPYDFFAACFISFP 45
>SYA_LEGPL (Q5WVQ2) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 860 Score = 28.9 bits (63), Expect = 3.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 83 VWILACLFYDVARLGCLHPLPK 18 +W L + ++ R GCLHPLPK Sbjct: 200 IWNLVFMQFNRDREGCLHPLPK 221
>HRP3_SCHPO (O14139) Chromodomain helicase hrp3 (EC 3.6.1.-) (ATP-dependent| helicase hrp3) Length = 1388 Score = 28.9 bits (63), Expect = 3.9 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = +2 Query: 47 WQHRKTSTPESIHGKPNYGNTMPQKKKLWQXXXSNYSPSPAYITGG 184 +Q R+ S G NYGN+ P+ +KL Q P+YITGG Sbjct: 337 FQEREESALSPSRGT-NYGNSRPKYRKLEQ--------QPSYITGG 373 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,977,156 Number of Sequences: 219361 Number of extensions: 464446 Number of successful extensions: 1049 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1049 length of database: 80,573,946 effective HSP length: 39 effective length of database: 72,018,867 effective search space used: 1728452808 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)