| Clone Name | rbags31l01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GRPE_MYCGA (Q7NBE4) Protein grpE (HSP-70 cofactor) | 28 | 4.6 | 2 | ATPA_ACEWO (P50000) ATP synthase alpha chain, sodium ion specifi... | 28 | 6.0 |
|---|
>GRPE_MYCGA (Q7NBE4) Protein grpE (HSP-70 cofactor)| Length = 298 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 7/41 (17%) Frame = -1 Query: 238 PASVSDEKYLSRDNKSAGHDYP-------YSSGYRASDDVL 137 P DEKY+S +K++ DYP SGY+ D V+ Sbjct: 163 PGDKFDEKYMSASDKASDPDYPADHVCKVMKSGYKLYDRVV 203
>ATPA_ACEWO (P50000) ATP synthase alpha chain, sodium ion specific (EC| 3.6.3.15) (Na(+)-translocating ATPase alpha chain) Length = 501 Score = 28.1 bits (61), Expect = 6.0 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 5/54 (9%) Frame = -1 Query: 271 GFP-----PVIPYHPLPASVSDEKYLSRDNKSAGHDYPYSSGYRASDDVLPVDR 125 GFP P++ H P V + R++ + P +GY+A D ++P+ R Sbjct: 112 GFPVDGKGPIVTDHRRPVEVKAAGVIERESVNQ----PIQTGYKAIDSMIPIGR 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,222,240 Number of Sequences: 219361 Number of extensions: 500324 Number of successful extensions: 1052 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1050 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)