| Clone Name | rbags31h14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZAN_RABIT (P57999) Zonadhesin (Fragment) | 31 | 2.7 | 2 | ENGC_SHEON (Q8EJ79) Probable GTPase engC (EC 3.6.1.-) | 30 | 4.7 |
|---|
>ZAN_RABIT (P57999) Zonadhesin (Fragment)| Length = 2282 Score = 31.2 bits (69), Expect = 2.7 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 Query: 215 PSCHRQELRCAASRAPSCCSDDNTC 289 PSC + RC +RAPS C++ TC Sbjct: 1685 PSCFDPDGRCEGARAPSSCAEGCTC 1709
>ENGC_SHEON (Q8EJ79) Probable GTPase engC (EC 3.6.1.-)| Length = 354 Score = 30.4 bits (67), Expect = 4.7 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 5/68 (7%) Frame = -1 Query: 545 GPELQGENVDTLFTSPEVLHTWASAIIDAYYSSREGT-----LLGQARDLMNPKIIKRVE 381 G ++ N+D + VL ++ + IID Y + E T ++ DL+ P+ +E Sbjct: 119 GVKIIASNIDQILIVSSVLPSFTTQIIDRYLVAAEDTDIPPIIILNKIDLLTPEEAPAIE 178 Query: 380 ELVKTIKD 357 E +K +D Sbjct: 179 EALKRYQD 186 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,504,029 Number of Sequences: 219361 Number of extensions: 1764547 Number of successful extensions: 4793 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4793 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)