| Clone Name | rbags31h03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | OREX_HUMAN (O43612) Orexin precursor (Hypocretin) (Hcrt) [Contai... | 28 | 6.6 | 2 | SWF1_NEUCR (Q7RWM9) Palmitoyltransferase SWF1 (EC 2.3.1.-) | 28 | 6.6 |
|---|
>OREX_HUMAN (O43612) Orexin precursor (Hypocretin) (Hcrt) [Contains: Orexin-A| (Hypocretin-1) (Hcrt1); Orexin-B (Hypocretin-2) (Hcrt2)] Length = 131 Score = 28.5 bits (62), Expect = 6.6 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 8/57 (14%) Frame = +2 Query: 263 LHGASNHQLGILGMLRFING--------ELIVRSITSHAMGCCSGALADRTPPSPRP 409 LHGA NH GIL + + +G + ++++ +HA G + P+PRP Sbjct: 53 LHGAGNHAAGILTLGKRRSGPPGLQGRLQRLLQASGNHAAGILTMGRRAGAEPAPRP 109
>SWF1_NEUCR (Q7RWM9) Palmitoyltransferase SWF1 (EC 2.3.1.-)| Length = 429 Score = 28.5 bits (62), Expect = 6.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +1 Query: 205 LDVIYDRAMLDAR*CFSPLIAWSIKSSTWNLGYASVHQW 321 L ++ RA + AR + L+ W + WN G H+W Sbjct: 218 LGLVIIRAKIQARFPYWTLMPWWTSTQAWNSGDLDFHRW 256 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,214,678 Number of Sequences: 219361 Number of extensions: 894160 Number of successful extensions: 1788 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1787 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)