| Clone Name | rbags31g11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NCLN_BRARE (Q6NZ07) Nicalin-1 precursor (Nicastrin-like protein 1) | 46 | 8e-05 | 2 | NCLN_RAT (Q5XIA1) Nicalin precursor (Nicastrin-like protein) | 44 | 4e-04 | 3 | NCLN_MOUSE (Q8VCM8) Nicalin precursor (Nicastrin-like protein) | 44 | 4e-04 | 4 | NCLN_CHICK (Q5ZJH2) Nicalin precursor (Nicastrin-like protein) | 41 | 0.003 | 5 | NCLN_HUMAN (Q969V3) Nicalin precursor (Nicastrin-like protein) | 40 | 0.006 |
|---|
>NCLN_BRARE (Q6NZ07) Nicalin-1 precursor (Nicastrin-like protein 1)| Length = 572 Score = 46.2 bits (108), Expect = 8e-05 Identities = 30/72 (41%), Positives = 38/72 (52%) Frame = -1 Query: 601 VQNDVLDGMFTFYDATKSTLNVYQVASVTFDLLFLLVLGSYLIVLFSFLVITTRGLDDLI 422 V+ D D F FYD K T+N Y+V FDLL + + SYL VL +L I GL L Sbjct: 503 VRADKRDPEFVFYDQLKQTMNAYRVKPAIFDLLLAVCIASYLGVL--YLAIQNFGL--LY 558 Query: 421 NIFRRPPSRKVK 386 RR + +VK Sbjct: 559 GFLRRVTAPRVK 570
>NCLN_RAT (Q5XIA1) Nicalin precursor (Nicastrin-like protein)| Length = 563 Score = 43.9 bits (102), Expect = 4e-04 Identities = 20/43 (46%), Positives = 25/43 (58%) Frame = -1 Query: 604 HVQNDVLDGMFTFYDATKSTLNVYQVASVTFDLLFLLVLGSYL 476 HV+ D D F FYD K +N Y+V FDLL L +G+YL Sbjct: 494 HVKADKRDPEFVFYDQLKQVMNAYRVKPAIFDLLLALCIGAYL 536
>NCLN_MOUSE (Q8VCM8) Nicalin precursor (Nicastrin-like protein)| Length = 563 Score = 43.9 bits (102), Expect = 4e-04 Identities = 20/43 (46%), Positives = 25/43 (58%) Frame = -1 Query: 604 HVQNDVLDGMFTFYDATKSTLNVYQVASVTFDLLFLLVLGSYL 476 HV+ D D F FYD K +N Y+V FDLL L +G+YL Sbjct: 494 HVKADKRDPEFVFYDQLKQVMNAYRVKPAIFDLLLALCIGAYL 536
>NCLN_CHICK (Q5ZJH2) Nicalin precursor (Nicastrin-like protein)| Length = 562 Score = 41.2 bits (95), Expect = 0.003 Identities = 19/47 (40%), Positives = 26/47 (55%) Frame = -1 Query: 604 HVQNDVLDGMFTFYDATKSTLNVYQVASVTFDLLFLLVLGSYLIVLF 464 HV+ D D F FYD K +N Y+V FDLL + + +YL V + Sbjct: 493 HVKADKRDPEFVFYDQLKQVMNAYRVKPAIFDLLLAVCIAAYLGVAY 539
>NCLN_HUMAN (Q969V3) Nicalin precursor (Nicastrin-like protein)| Length = 563 Score = 40.0 bits (92), Expect = 0.006 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = -1 Query: 604 HVQNDVLDGMFTFYDATKSTLNVYQVASVTFDLLFLLVLGSYL 476 HV+ D D F FYD K +N Y+V FDLL + + +YL Sbjct: 494 HVKADKRDPEFVFYDQLKQVMNAYRVKPAVFDLLLAVGIAAYL 536 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,155,455 Number of Sequences: 219361 Number of extensions: 1388126 Number of successful extensions: 2702 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2701 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5710231900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)