| Clone Name | rbaal1l23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FILA_MOUSE (P11088) Filaggrin (Fragment) | 30 | 4.9 | 2 | SHH_RAT (Q63673) Sonic hedgehog protein precursor (SHH) [Contain... | 30 | 6.5 | 3 | Y241_METJA (Q57693) Hypothetical protein MJ0241 | 30 | 6.5 | 4 | ZFNL4_ARATH (Q94AD9) Zinc finger CCCH type domain-containing pro... | 30 | 6.5 | 5 | SI1L2_RAT (Q5JCS6) Signal-induced proliferation-associated 1-lik... | 30 | 6.5 |
|---|
>FILA_MOUSE (P11088) Filaggrin (Fragment)| Length = 336 Score = 30.4 bits (67), Expect = 4.9 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 387 HHDYTSTQEHQAGYSYTQQTNQEHQESSQH 476 H + S +HQ G+ + QQ +HQ QH Sbjct: 157 HSEEESDSQHQHGHQHEQQRGHQHQHQHQH 186
>SHH_RAT (Q63673) Sonic hedgehog protein precursor (SHH) [Contains: Sonic| hedgehog protein N-product; Sonic hedgehog protein C-product] Length = 437 Score = 30.0 bits (66), Expect = 6.5 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -3 Query: 188 VSAGIDWVYTKRKASVNDQIKAGFFSFSYPSEGC 87 V AG DWVY + KA ++ +KA S + S+GC Sbjct: 167 VEAGFDWVYYESKARIHCSVKAE-NSVAAKSDGC 199
>Y241_METJA (Q57693) Hypothetical protein MJ0241| Length = 145 Score = 30.0 bits (66), Expect = 6.5 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -1 Query: 664 LCIVCVDRKGMMAEVTSALTACGITICSCVAERD 563 L IV DR G++A++TS ++ G I S V ER+ Sbjct: 79 LQIVAKDRIGLLADITSRISKIGGNITSTVLERE 112
>ZFNL4_ARATH (Q94AD9) Zinc finger CCCH type domain-containing protein ZFN-like 4| Length = 404 Score = 30.0 bits (66), Expect = 6.5 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 469 LNTGACAHLQLCSHSHQSPQNGTAAHPFLFCYLSLP 576 L TGAC + C + H +NG A P +F + LP Sbjct: 100 LKTGACKYGPTCKYHHPKDRNG--AQPVMFNVIGLP 133
>SI1L2_RAT (Q5JCS6) Signal-induced proliferation-associated 1-like protein 2| (Serine-rich synapse-associated protein) Length = 1722 Score = 30.0 bits (66), Expect = 6.5 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +2 Query: 521 PLKMEQQHTHSSSVISLCHTRTYGDSASCQSRSNFSHHPFSINTHYAK 664 P KM H ++S++ S + GD + S S+ SH S +TH +K Sbjct: 1311 PAKMYTLHGYASAISSSAADGSMGDLSEVSSHSSGSHRSGSPSTHCSK 1358 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,042,479 Number of Sequences: 219361 Number of extensions: 1979659 Number of successful extensions: 4803 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4795 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)