| Clone Name | rbags31f01 |
|---|---|
| Clone Library Name | barley_pub |
>MUSK_HUMAN (O15146) Muscle, skeletal receptor tyrosine protein kinase| precursor (EC 2.7.10.1) (Muscle-specific tyrosine protein kinase receptor) (Muscle-specific kinase receptor) (MuSK) Length = 869 Score = 29.6 bits (65), Expect = 2.1 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 228 SGSNYFSVSCTIVVRAFHLLVAGLCFFIFLVITVLYC 118 S S+ FSVS T + +++ F+ L IT LYC Sbjct: 481 SSSSSFSVSPTYSMTVIISIMSSFAIFVLLTITTLYC 517
>NUCB2_HUMAN (P80303) Nucleobindin-2 precursor (DNA-binding protein NEFA)| (Gastric cancer antigen Zg4) Length = 420 Score = 29.3 bits (64), Expect = 2.8 Identities = 20/75 (26%), Positives = 37/75 (49%) Frame = +1 Query: 22 EHYINXRRFTLKIHPLLC*GGLPNEIXREILSTVQYSNDKKNKKTQSRDKQMKSSHDNST 201 EHY R K + ++ RE L T+ N++K K+ +S+ ++MK H+N Sbjct: 167 EHYDKTRHEEFKKYEMM-----KEHERREYLKTL---NEEKRKEEESKFEEMKKKHEN-- 216 Query: 202 *NGKIVGTGEESQVR 246 + K+ G + Q++ Sbjct: 217 -HPKVNHPGSKDQLK 230
>SIR4_YEAST (P11978) Regulatory protein SIR4 (Silent information regulator 4)| Length = 1358 Score = 28.9 bits (63), Expect = 3.6 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 4/61 (6%) Frame = +1 Query: 88 PNEIXREILSTVQYSNDKK----NKKTQSRDKQMKSSHDNST*NGKIVGTGEESQVRLAE 255 P EI R+IL T + SN+ K N +S++ + S+H + +GT + QV A Sbjct: 554 PKEIVRDILHTKESSNEAKKTIQNPLNKSQNTALPSTHKVTQKKDIKIGTNDLFQVESAP 613 Query: 256 R 258 + Sbjct: 614 K 614
>ATP6_BUCAP (O51878) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 272 Score = 28.1 bits (61), Expect = 6.2 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -1 Query: 180 FHLLVAGLCFFIFLVITVLY 121 FH+L+ L FIF+V+T++Y Sbjct: 245 FHILIISLQAFIFMVLTIVY 264
>ATP6_BUCBP (Q89B45) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 274 Score = 28.1 bits (61), Expect = 6.2 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -1 Query: 180 FHLLVAGLCFFIFLVITVLY 121 FH+L+ L FIF+V+T++Y Sbjct: 247 FHILIISLQSFIFMVLTIVY 266
>ATP6_BUCAI (P57118) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 274 Score = 28.1 bits (61), Expect = 6.2 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -1 Query: 180 FHLLVAGLCFFIFLVITVLY 121 FH+L+ L FIF+V+T++Y Sbjct: 245 FHILIISLQAFIFMVLTIVY 264
>AP1M1_SCHPO (Q9HFE5) AP-1 complex subunit mu-1 (Mu(1)-adaptin) (Clathrin| assembly protein complex 1 medium chain) Length = 426 Score = 27.7 bits (60), Expect = 8.1 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +2 Query: 83 GYPTKSDEKFCQQYSTVMTRKIKKHNP 163 G+P ++ K Q+Y T + +KKH P Sbjct: 121 GFPQTTETKILQEYITQTSNTVKKHAP 147
>YG1O_YEAST (P53222) Hypothetical 12.9 kDa protein in RPL26B-ACB1 intergenic| region Length = 116 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +1 Query: 88 PNEIXREILSTVQYSNDKKNKKTQSRDKQMKSSHDNST*NGKIVGTGEESQ 240 P++I R L ND K K+Q R+K ++S+ + + T E Q Sbjct: 60 PSKITRYDLIKAAAENDLKRSKSQGREKSRRNSNRRNNEEIFVANTASEIQ 110 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,177,643 Number of Sequences: 219361 Number of extensions: 516906 Number of successful extensions: 1582 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1582 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)