| Clone Name | rbags30p24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YCE5_YEAST (P25574) Hypothetical 87.2 kDa protein in APA1/DTP-PD... | 40 | 0.004 | 2 | YCQ9_SCHPO (O13674) Hypothetical RNA-binding protein C74.09 in c... | 32 | 1.2 | 3 | CYPC_BACSU (O31440) Cytochrome P450 152A1 (EC 1.14.-.-) (P450BsB... | 30 | 3.5 | 4 | CYNT_SYNP7 (P27134) Carbonic anhydrase (EC 4.2.1.1) | 29 | 7.8 |
|---|
>YCE5_YEAST (P25574) Hypothetical 87.2 kDa protein in APA1/DTP-PDI1 intergenic| region Length = 760 Score = 40.0 bits (92), Expect = 0.004 Identities = 16/39 (41%), Positives = 27/39 (69%) Frame = -1 Query: 536 IVSIPAKLESTTLVFTYGVDLFYTRLAPSRTYDSLTDEF 420 ++SIP LEST+++ G+D+F TR+ PS +D ++ F Sbjct: 687 LISIPTNLESTSIICDLGLDVFCTRITPSGQFDLMSPTF 725
>YCQ9_SCHPO (O13674) Hypothetical RNA-binding protein C74.09 in chromosome III| Length = 654 Score = 32.0 bits (71), Expect = 1.2 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +3 Query: 6 FYXKKVHVEYENFNKLQSTNILLKSLVAEVHFITYKDATSDLPVL*C 146 ++ K++ + F K++ IL K +A VHF+ +DA + L C Sbjct: 310 YHEKEIEEAFGKFGKIEHIKILSKKNIAFVHFLNIRDAIKVVRTLSC 356
>CYPC_BACSU (O31440) Cytochrome P450 152A1 (EC 1.14.-.-) (P450BsBeta) (Fatty| acid beta-hydroxylase) Length = 417 Score = 30.4 bits (67), Expect = 3.5 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Frame = +2 Query: 161 LTAQVPHAVSSQESNFTLK---CYINNRTLALNKRKITMSTRAQNFICITTLEAS 316 + Q+PH S S LK +I NRT N +NFIC+T EA+ Sbjct: 1 MNEQIPHDKSLDNSLTLLKEGYLFIKNRTERYNSDLFQARLLGKNFICMTGAEAA 55
>CYNT_SYNP7 (P27134) Carbonic anhydrase (EC 4.2.1.1)| Length = 272 Score = 29.3 bits (64), Expect = 7.8 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 8/82 (9%) Frame = -3 Query: 327 VEVIEASNVVMQMKFWALVDIVIFLLFSARVLLFM*HFKVKFD--------SWDDTA*GT 172 VE++ A NV+ Q++ IV LF ++ +F ++V+ S DDT Sbjct: 147 VEILVAENVLTQIENLKTYPIVRSRLFQGKLQIFGWIYEVESGEVLQISRTSSDDTGIDE 206 Query: 171 CAVRNPGHDIKELADHSWHPYT 106 C VR PG K + P T Sbjct: 207 CPVRLPGSQEKAILGRCVVPLT 228 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,227,352 Number of Sequences: 219361 Number of extensions: 1347653 Number of successful extensions: 2809 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2809 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)