| Clone Name | rbags31e20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TUSD_BUCAP (Q8K944) Sulfurtransferase tusD (EC 2.8.1.-) (tRNA 2-... | 32 | 2.0 | 2 | AOX_YARLI (Q8J0I8) Alternative oxidase, mitochondrial precursor ... | 30 | 4.5 | 3 | TDXH_METMP (Q6LY19) Probable peroxiredoxin (EC 1.11.1.15) | 30 | 5.9 | 4 | VIT6_CAEEL (P18948) Vitellogenin 6 precursor | 30 | 7.7 |
|---|
>TUSD_BUCAP (Q8K944) Sulfurtransferase tusD (EC 2.8.1.-) (tRNA 2-thiouridine| synthesizing protein D) Length = 128 Score = 31.6 bits (70), Expect = 2.0 Identities = 19/65 (29%), Positives = 29/65 (44%) Frame = -1 Query: 413 FMSPTGTTFDALGLVKQINEQNAPXXXXXXXXXASRSLCNEENIKHIVIKKEHVTTNQTS 234 F P+ FD L KQ+NE+N + R + +E I + IK + + S Sbjct: 50 FNKPSVDEFDLLSAWKQLNEKNKVKLYVCVSAASRRGVIEDEKISNTKIKNGNFASFFQS 109 Query: 233 NGLSE 219 +GL E Sbjct: 110 SGLLE 114
>AOX_YARLI (Q8J0I8) Alternative oxidase, mitochondrial precursor (EC 1.-.-.-)| Length = 353 Score = 30.4 bits (67), Expect = 4.5 Identities = 14/52 (26%), Positives = 28/52 (53%) Frame = +3 Query: 198 VEIKNPCFGQAVGCLIGCNMFLLDNNMFYVFLIT*APTCQEFMGFLQSRSVL 353 ++++ P G LIG +F N+F++ + TC F+G+L+ +V+ Sbjct: 204 LKLQKPSVQMRTGLLIGQIIFY---NLFFISYLISPATCHRFVGYLEEEAVI 252
>TDXH_METMP (Q6LY19) Probable peroxiredoxin (EC 1.11.1.15)| Length = 217 Score = 30.0 bits (66), Expect = 5.9 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = -1 Query: 614 RKLNTPTKSFSKDIIFSRSKPTELLVEKSYADYEYVNILADTPG---IKRGLESP 459 R+LNT S D +FS K E + EK D E+ I+AD G +K G+ SP Sbjct: 61 RELNTELIGLSIDQVFSHIKWVEWIKEKLDVDIEF-PIIADDRGELAVKLGMISP 114
>VIT6_CAEEL (P18948) Vitellogenin 6 precursor| Length = 1650 Score = 29.6 bits (65), Expect = 7.7 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -3 Query: 282 KTYCYQEGTCYNQSDIQRLVRSKDS*FQRVHHTCEEERRQEM 157 K+Y Y++ C + +R + K+ FQR+ EEE+ QEM Sbjct: 1505 KSYLYKDSKC----NYEREMFEKEENFQRIEKNQEEEKDQEM 1542 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,875,756 Number of Sequences: 219361 Number of extensions: 1881830 Number of successful extensions: 3974 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3893 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3974 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5824436538 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)