| Clone Name | rbags31e13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | O5AT1_HUMAN (Q8NHC5) Olfactory receptor 5AT1 | 30 | 3.4 | 2 | YCF2_PINTH (P41653) Protein ycf2 | 30 | 5.9 | 3 | CEF1_NEUCR (Q7SAF6) Pre-mRNA-splicing factor cef-1 | 29 | 7.7 |
|---|
>O5AT1_HUMAN (Q8NHC5) Olfactory receptor 5AT1| Length = 309 Score = 30.4 bits (67), Expect = 3.4 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 17/82 (20%) Frame = -3 Query: 209 LLMPIADHRSDCICLIHISFVLLYCCKL*TS-----------------RYCLKGLSFGFL 81 +LM + +++ CI L I F+L+Y C L + + LK LSF L Sbjct: 11 ILMGFSTNKNMCI-LHSILFLLIYLCALMGNVLIIMITTLDHHLHTPVYFFLKNLSFLDL 69 Query: 80 CLLMLPLFKTISRILVNNHVLS 15 CL+ + K+I+ L++N+ +S Sbjct: 70 CLISVTAPKSIANSLIHNNSIS 91
>YCF2_PINTH (P41653) Protein ycf2| Length = 2054 Score = 29.6 bits (65), Expect = 5.9 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Frame = +2 Query: 14 NLRHDCSPRYEIWF*TMATST---NREIQNLDLLSNT*TFIAYNSKEEQNLYELNRCSQT 184 N + PR + WF T N +I LSN+ SKEEQN+Y +++ Sbjct: 961 NKNEEIFPRIQDWFVTECLKNKIVNEDIDGRSTLSNS-------SKEEQNIYRISQIDSI 1013 Query: 185 YDLRW 199 + +W Sbjct: 1014 FS-KW 1017
>CEF1_NEUCR (Q7SAF6) Pre-mRNA-splicing factor cef-1| Length = 779 Score = 29.3 bits (64), Expect = 7.7 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 514 PVEEDLGNKAKGEEDRREDEYKK 446 P ++ +GNK KGEED R+ + +K Sbjct: 254 PKKQQVGNKRKGEEDERDGKRRK 276 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,393,835 Number of Sequences: 219361 Number of extensions: 957040 Number of successful extensions: 2160 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2160 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4430660157 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)