| Clone Name | rbags31c17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PIT1_SCHPO (O14132) Sporulation protein kinase pit1 (EC 2.7.11.1) | 30 | 4.9 | 2 | YG22_YEAST (P53235) Hypothetical 71.3 kDa protein in SCM4-MUP1 i... | 30 | 8.3 | 3 | PPNK_CAMJR (Q5HVD0) Probable inorganic polyphosphate/ATP-NAD kin... | 30 | 8.3 | 4 | PPNK_CAMJE (Q9PHM6) Probable inorganic polyphosphate/ATP-NAD kin... | 30 | 8.3 |
|---|
>PIT1_SCHPO (O14132) Sporulation protein kinase pit1 (EC 2.7.11.1)| Length = 650 Score = 30.4 bits (67), Expect = 4.9 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = -1 Query: 614 ESCQSIGDASGGSFSSSELNGQPLNDALLDMESSSFGFLSQIPRNFSFSDL 462 E Q+ GD GG + +EL L +L M FG L P N +F+ + Sbjct: 262 EQSQNTGDKGGGIWDRAELLANKLGISLPKMAPLDFGDLFSPPWNLAFASM 312
>YG22_YEAST (P53235) Hypothetical 71.3 kDa protein in SCM4-MUP1 intergenic| region Length = 642 Score = 29.6 bits (65), Expect = 8.3 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Frame = -1 Query: 659 DSSNADFAFCGNAFLESCQSIGDASGGSFSSSELNGQPLNDALLDMESSSFGFLS-QIPR 483 DSSN + +L S Q + GG+ L P++D S FG ++ +P Sbjct: 256 DSSNKSYYGENTLYLLSFQGVNGTLGGNSVRVSLTTGPVHDFTWSPTSRQFGVIAGYMPA 315 Query: 482 NFSFSDL 462 SF DL Sbjct: 316 TISFFDL 322
>PPNK_CAMJR (Q5HVD0) Probable inorganic polyphosphate/ATP-NAD kinase (EC| 2.7.1.23) (Poly(P)/ATP NAD kinase) Length = 286 Score = 29.6 bits (65), Expect = 8.3 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +3 Query: 51 QYLRQXNITATNGGSYSHNINVQGRHNYNTFGKQPGGRTTACSHQVTTHPILL 209 +Y I AT GS ++N++ G Y Q T CSH +T PI+L Sbjct: 174 EYFGDGLIVATPAGSTAYNLSANGPIVYTL--AQAFILTPVCSHSLTQRPIVL 224
>PPNK_CAMJE (Q9PHM6) Probable inorganic polyphosphate/ATP-NAD kinase (EC| 2.7.1.23) (Poly(P)/ATP NAD kinase) Length = 286 Score = 29.6 bits (65), Expect = 8.3 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +3 Query: 51 QYLRQXNITATNGGSYSHNINVQGRHNYNTFGKQPGGRTTACSHQVTTHPILL 209 +Y I AT GS ++N++ G Y Q T CSH +T PI+L Sbjct: 174 EYFGDGLIVATPAGSTAYNLSANGPIVYTL--AQAFILTPVCSHSLTQRPIVL 224 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,021,940 Number of Sequences: 219361 Number of extensions: 2075980 Number of successful extensions: 5641 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5639 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6314008338 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)