| Clone Name | rbags30n15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LMO7_HUMAN (Q8WWI1) LIM domain only protein 7 (LOMP) (F-box only... | 30 | 7.3 |
|---|
>LMO7_HUMAN (Q8WWI1) LIM domain only protein 7 (LOMP) (F-box only protein 20)| Length = 1683 Score = 30.0 bits (66), Expect = 7.3 Identities = 30/101 (29%), Positives = 43/101 (42%), Gaps = 9/101 (8%) Frame = -1 Query: 711 RVQKQATDDRYYICVCHAQVVGRSLS---------PVFMVDINDSGGNAILKHLPEAKNL 559 R Q Q +D R I Q G+SL P V ++G A L + Sbjct: 1033 RSQDQFSDMRISI----NQTPGKSLDFGFTIKWDIPGIFVASVEAGSPAEFSQLQVDDEI 1088 Query: 558 TVTEVVQDSATDSQEWKDALASYREMRHLVTLMNVLQEGPA 436 + S DS+EW++A+A +E HLV M+V + G A Sbjct: 1089 IAINNTKFSYNDSKEWEEAMAKAQETGHLV--MDVRRYGKA 1127 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,212,973 Number of Sequences: 219361 Number of extensions: 1439178 Number of successful extensions: 4770 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4750 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7196276819 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)